KEGG   Danio rerio (zebrafish): 100000903Help
Entry
100000903         CDS       T01004                                 

Gene name
prf1.1
Definition
perforin 1.1
Orthology
K07818  
perforin 1
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 580 aa AA seqDB search
MRAGLFFYLLLPVVQSCTKGKPKECEEATFAPGSNLAGEGYDVIKMQRKGAFVINTDVWR
QKDKSCTLCKNPYMDGALQKLPLSVVDWRTSQKCTVKVSSSLYHSSEDLVSSSASSIENN
WGASLGIEAKKTTGSIVLAGSKSKLAEYSMEKTKKDKFNFASQSISCAYYSYRVSNKPVL
HPEFKRSVKELPKTYNLQFKPRFYKFINTFGTHYITKVTLGGNVHSVTSIRQCETALQGL
STDEVKACLDLEANMSILGKADMKAESKHCSQNQDKTESKTSFSSRFNDRLTEVTGGHTT
EPELLFSGGKDPSAYKEWLASLPQNPDVISHSLESLHELIPTKYPVRKHMRQAIHDYILE
NSLWRNCTDPCTNGVKTNPNNPCVCTCHNKPGITPDCCPSKRGLSRVQVTVVKAQDLWGD
TTTATDGYVKVFDKNNVKIGSTNMIPNNNSPYWGQTFDLGDVILAENDNIKLEVWDEDSK
WDDDLLGTCQVAIKVDQSQTYNFCSLNHGLLYYNTKVTCAPGLAGTYCEKYVGSPMNFHL
EKVYVSRNARPVPPEILLSHGVLLDRLYVYHKTNYNNTVL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgagggctggattgtttttttaccttctcttgcctgttgtgcagtcctgcactaaaggt
aaacccaaagagtgtgaagaagcaacctttgcacccggatctaacctggccggagaagga
tacgacgtgatcaagatgcagcgcaagggagcttttgtcatcaacacagacgtctggagg
caaaaggacaaatcctgcaccctctgcaagaacccctatatggacggagctttacaaaag
cttcctctgtcagtggtggactggagaaccagccaaaaatgcaccgtgaaagtctccagt
tctctataccattccagcgaggacctggtgagctccagcgcctcctctattgagaacaac
tggggtgcaagtttggggatagaggctaaaaaaacaacaggctcgatagttttggcagga
agcaagtcaaagcttgcagagtactcaatggagaagaccaaaaaagacaagttcaacttt
gcaagtcaaagtatttcctgtgcttattacagctatcgagtctccaacaagcctgttctc
catcctgagttcaaacgatctgtgaaggagcttcccaagacatacaaccttcaattcaag
ccgcgtttctacaagttcattaacacctttggaacccattacatcacaaaggtaactctt
ggcggaaacgtgcactcagtgaccagtatcagacaatgtgaaaccgctcttcagggctta
agcacagacgaagtaaaggcctgcttggatttggaggcaaatatgagcattcttggcaaa
gcagacatgaaagccgaatcaaaacactgtagtcaaaatcaggacaaaacagagagcaaa
accagcttctccagccgcttcaatgacaggctgaccgaggtcaccggaggtcacaccaca
gagcccgagctccttttttcaggagggaaagacccatcagcttacaaagaatggctggcg
tccctgccgcaaaacccagatgtgatttctcactctctggagtccctgcacgagctgatc
cccaccaaatacccagtgcgcaaacacatgcgccaagccatccacgactacatcctggaa
aattccctttggaggaactgcaccgacccctgcactaatggcgtcaaaaccaacccaaac
aatccatgtgtctgcacttgccacaacaaacccggaatcacaccagactgttgcccgtcc
aaacgtggactctctcgggtgcaggtcacggtcgttaaggctcaagatctttggggtgac
acaaccacagcgaccgatggctatgttaaagtgttcgacaaaaataacgtgaagattgga
tccacaaatatgataccgaataacaattcaccctactgggggcaaaccttcgatctgggt
gatgtcatcctggcagagaatgacaatatcaaactggaggtgtgggatgaagacagtaaa
tgggatgacgatttgttgggaacctgtcaggtagccataaaagtagatcagagtcagacc
tacaatttctgcagtttgaatcatggtttgctctattacaatacaaaagtgacatgcgcc
cccggtttggctggcacctattgtgaaaagtatgtgggttcccccatgaactttcacctg
gagaaggtttacgtgtctcgaaatgcacgacctgtgccaccagaaatacttttaagccat
ggagtgcttctggacagactttacgtatatcacaagacaaattacaataatacagttttg
tag

DBGET integrated database retrieval system