KEGG   Danio rerio (zebrafish): 100001532Help
Entry
100001532         CDS       T01004                                 

Gene name
plcb3, Plcbeta3, she, si:ch211-188c22.1, si:zc188c22.1, wu:fl04b08
Definition
phospholipase C, beta 3 (phosphatidylinositol-specific) (EC:3.1.4.11)
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
GnRH signaling pathway
Melanogenesis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100001532 (plcb3)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100001532 (plcb3)
   04020 Calcium signaling pathway
    100001532 (plcb3)
   04070 Phosphatidylinositol signaling system
    100001532 (plcb3)
 Cellular Processes
  Cell communication
   04540 Gap junction
    100001532 (plcb3)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    100001532 (plcb3)
   04916 Melanogenesis
    100001532 (plcb3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100001532 (plcb3)
   04270 Vascular smooth muscle contraction
    100001532 (plcb3)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100001532 (plcb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
7
AA seq 1244 aa AA seqDB search
MAGAKPGVHALQLKPVSVNEVLKRGSKFIKWDEEANSTPSLITLRVDPNGFFLYWTGGTS
MEAEILDMSHIRDTRTGKFAKTPKDQRIREMLFSGKADGNSDSRLLTVVYGNDLVNISFL
NFQAVQDGYCKLWTDELFKLATNMLSQNASRNTFLLKAYTKLKLQVTQDGKIPVKNILKM
FSDKKRVEMALEHCGLIFNRVDGIKPDDFTWEMFQNFLNKLSPRPEVERIFVDLGSKGKP
FLSLDQLMDFINRKQRDSRLNEVLYPPLKRDQVRQLMEKYETNTSQLERDQISLMSFTKY
LGGEENTVVPPERLDIIDDMNQPLSHYFINSSHNTYLTVGQLTGLSSVEMYRQVLLTGCR
CIELDCWKGRPPEEEPIITHGFTMTTEIPFKDVIEAIAESAFKTSPYPLILSFENHVDSA
KQQAKMAEYCRSMFGDALLIDPLDKYPLVPGQQLPSPQELLGKILIKNKKKHHHRASNGG
SIRRKDGTDEQSSPLNDCPLSDGDVGQLMSNGGEKLAERMAKDHDNSKSIDRGDGESDEE
EEEEPIPDPKKHNNTDEGTAYSEVNATEEMSTLVNYIEPVKFKSFEVAAKRKKFFEMSSF
VETKGMDTLKNSPTEFVEYNKKQMSRIYPKGTRVDSSNYMPQLFWNVGCQMVALNFQTLD
LAMQLNMGVFEYNGRCGYLLKPEFMRRTDKHFDPFTTDIVDGIVANTVKVKIISGQFLND
KKVGVYVEVDMFGLPADTKRKYRTKTSNNNSLDPVWDDETFVFNKVVLPTLASLRVAVYE
ENGKFIGHRILPVSALRPGYHYICLKNELNQPLMLPSLLVYTEVQDYIPNEHQEYAEALT
NPIKHLSLLAQRESQLLALMEDPTEGGPTKQEEGDGTDSSCVTSADPIFPLPSSPTLPSV
PTDLNPPPSGQKEDLVNNVLKVIEPESIDELKQHNSYLKLLKKQCKEFKELSKKHLKKML
ALSKEQKTLFNQQSSELQRKRSQIEKRIRTSLKKNGSEDSVHRELNELDLELQKQMEQFR
EEHMQKLLVLRQGQLQMEKEVKQFHLKEANQKLKDIAIECQAAQIKKLKDVCDKEKKELQ
KMLDRKRLNSIVEARKAEKEIDVNEINRKHIQESVSLIRQLEVSQGKRQEKLKALHKDIL
QKIEEEIPMNQARLTRDFEAELKRLPEEISQYLQELESKGSRKDSLMGQTNDGPNSGPPS
NCSTPPYSSPNHSWSNIANVSSLLLDSSTSSTSAKSETDTTGVY
NT seq 3735 nt NT seq  +upstreamnt  +downstreamnt
atggccggggcgaaaccgggagttcacgcgttgcagctcaaaccggtgtctgtcaatgag
gtcctcaaacgggggagcaagtttatcaaatgggacgaggaggccaacagcacacccagc
ctgatcaccctcagagtggacccaaatggattctttctttactggactggaggaaccagc
atggaagcggaaatcctggacatgagtcatatcagggacaccaggacagggaagtttgct
aagacgccaaaggaccaacgtattcgtgaaatgttgttttcgggcaaagcagatgggaac
tctgactcaaggctgctaacggtcgtctacggcaacgacctggtcaacatctctttcctc
aacttccaagctgtgcaggatggctattgcaagttgtggacggatgaactgtttaaactt
gccacaaatatgctgtcccagaatgcttcccgcaacaccttcttactcaaagcttacaca
aagctaaagttgcaggtaactcaggatgggaaaatcccagtaaagaacatcctaaaaatg
ttctcggataagaaacgtgtggagatggcgctggagcactgcggtcttatctttaacagg
gtggacggtataaaaccagatgacttcacctgggaaatgttccagaactttttaaacaaa
ctaagtcccagaccagaggtggagcgaatttttgtagatctagggtctaaagggaagccc
ttcttgtccttggatcagttgatggacttcataaatcgcaaacagagggattcacgacta
aatgaggttctttaccctccactcaaacgagatcaggtccgccagctcatggagaaatat
gagaccaacaccagccagctggagagagatcagatctccctgatgagcttcacaaagtat
cttggcggagaggaaaacactgtggttccccctgagaggctggacattatcgatgatatg
aaccagccgctgtcccactatttcatcaactcatcacacaacacataccttacggtgggg
cagctgacaggcctgtcttcagttgagatgtacagacaggtgttgctgacaggatgccgc
tgtatagagctggattgttggaagggccgcccacctgaagaagagccaatcatcactcat
ggtttcaccatgacaactgagatcccattcaaggatgtgattgaagccattgctgaaagt
gctttcaagacgtcaccttaccctctcatcctgtcctttgagaaccacgtggactcagca
aagcagcaggctaaaatggctgaatattgtcgctcaatgtttggggatgcgctgctcatt
gacccactggacaaatatccgctggttcctggtcaacaactcccaagcccccaggagctg
ttggggaagatcttgatcaagaacaagaagaaacatcaccacagggcctctaacggtggg
agcatccgacgcaaggatgggacagatgaacagtcttcacctttgaatgattgtccattg
tctgatggggatgtgggccagctcatgtccaatgggggtgagaagcttgcagagaggatg
gccaaagaccatgataacagcaaatctattgatcggggagatggtgagagtgatgaggag
gaggaagaggaacccattccagatccaaagaaacacaacaacactgatgagggtactgca
tatagtgaggtgaatgccacagaggagatgtccacattggtcaactacatagaaccagtc
aaattcaagtcttttgaggtggcagccaagaggaaaaagttctttgagatgtcatctttt
gtggagaccaaaggcatggacacattgaaaaattctcccaccgagtttgttgaatataat
aaaaagcaaatgagtcgcatttaccccaaagggactcgtgtggactccagcaactatatg
ccacagcttttctggaacgtgggctgccagatggtggcactaaacttccaaacccttgac
ctggcgatgcagctgaacatgggggtgtttgaatacaatggccgctgtggctatctgctg
aaaccggagttcatgagacgcactgacaaacactttgacccctttactacagacattgtg
gatggcattgtagccaatacagttaaagtcaagatcatctcaggccagtttctaaatgat
aagaaggttggtgtttatgtggaggtggacatgtttgggcttcctgcagacactaaaagg
aaatatcgaacaaaaacttcaaacaacaactctctggacccagtctgggatgatgaaacc
tttgtgttcaataaggtggtgttacctacgctagcatctctgagagtggcggtatatgaa
gaaaacggaaagtttattggtcatcgtatcttgccagtgtcagcgttgcgcccaggatat
cactacatctgtctaaagaatgaactgaaccaaccactcatgctgccttccctgcttgtg
tacactgaggtacaggactacattcccaacgagcaccaagaatatgcagaggctctaaca
aaccccatcaagcatctctctctgctggcccagagagaaagtcagctattagcacttatg
gaggatcccactgagggtgggcctacaaaacaggaggaaggagacgggactgactctagc
tgcgtgacctctgctgaccctatcttccctctgccctcatctccaacacttcctagtgta
ccaactgacttgaaccctcctccatcaggccaaaaagaagatctagtcaacaatgtcctt
aaagtaatcgagcctgagtctattgatgagcttaaacaacacaattcctacctgaagctg
ctgaagaagcaatgcaaggaatttaaggagctgagcaagaaacatctcaaaaagatgttg
gccctcagtaaggaacaaaagactctctttaatcagcagagctcggaactacagaggaaa
cgcagtcagattgagaagcgtatacgcacaagtctaaagaaaaatggatcagaagattct
gtgcatagggaattaaatgagctggatctggagctacagaaacaaatggagcagttcaga
gaggagcacatgcaaaagcttcttgtactcagacaaggacagcttcagatggagaaagaa
gtgaaacagttccacctcaaagaggccaatcagaaactgaaggatattgccatcgaatgc
caagcagcccagatcaagaaactcaaagatgtgtgtgacaaagagaaaaaggagttgcag
aagatgctggatagaaagaggctaaacagcatagttgaggccagaaaagcagaaaaggag
atagatgtgaacgagatcaatagaaaacatatccaagagtcggtcagcttaatccgtcag
ctggaagtatctcaggggaagcgtcaggagaagttgaaagcccttcataaggacatcctt
cagaaaatcgaggaggaaattcctatgaatcaggcccgtttgacccgtgactttgaggca
gagctaaagcgtttgccagaggagatttctcaatatctgcaggagcttgagagcaaaggc
tctcggaaagacagcttgatgggtcagaccaatgacggcccaaactctggccccccatcc
aactgcagcacaccaccttactcctcccccaaccacagctggagcaacatagccaatgtt
tcatccttactgctggactcctccacctcaagcacttctgccaagtccgagacagacact
acaggagtctactaa

DBGET integrated database retrieval system