KEGG   Danio rerio (zebrafish): 100003223Help
Entry
100003223         CDS       T01004                                 

Gene name
ppp1cb
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03015  mRNA surveillance pathway
dre04114  Oocyte meiosis
dre04218  Cellular senescence
dre04261  Adrenergic signaling in cardiomyocytes
dre04270  Vascular smooth muscle contraction
dre04510  Focal adhesion
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100003223 (ppp1cb)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100003223 (ppp1cb)
   04218 Cellular senescence
    100003223 (ppp1cb)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100003223 (ppp1cb)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100003223 (ppp1cb)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100003223 (ppp1cb)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100003223 (ppp1cb)
   04270 Vascular smooth muscle contraction
    100003223 (ppp1cb)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100003223 (ppp1cb)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100003223 (ppp1cb)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100003223 (ppp1cb)
Transcription machinery [BR:dre03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100003223 (ppp1cb)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100003223 (ppp1cb)
Spliceosome [BR:dre03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100003223 (ppp1cb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 100003223
NCBI-ProteinID: NP_001004527
ZFIN: ZDB-GENE-030616-609
Ensembl: ENSDARG00000044153
Vega: OTTDARG00000035067
UniProt: Q1JPZ8
Position
17
AA seq 327 aa AA seqDB search
MAEGELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANNLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEK
KAKYQYSGVNSGRPVTPPRTAQAPKKR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcggagggggaattaaacgttgacagtctcatctctcgacttcttgaagtgcgagga
tgtcgtcctgggaagattgttcagatgacggaagcagaagttcgaggactctgcattaag
tctcgagagatcttcctcagccagcccatcctgctggagctggaggcgccacttaaaatc
tgtggtgacatccatgggcagtacacagatctgttgaggttgtttgaatatggtggtttt
ccaccggaggcaaacaatctctttctgggtgattatgtggaccgaggaaagcagtctttg
gagaccatctgcctcctgctggcctataagatcaaatacccagagaatttcttcctcctg
aggggaaaccatgagtgcgcctccatcaaccgtatctatggcttctatgatgagtgcaag
cgcaggttcaacatcaagctctggaagacattcacagactgctttaactgcctcccaatc
gctgccatcatagatgagaagattttctgttgccatggaggtctttctcctgatctgcag
tcaatggaacagatacgtcgaattatgcgaccaactgatgtcccagatacagggttgctg
tgtgatttgctgtggtcagaccccgataaggacgttcagggatggggagagaatgatcgt
ggtgtttcattcacgtttggtgctgatgtagtcagcaaattcctgaaccgccacgacctg
gacttaatctgtagggcacatcaggtggttgaggatggttatgaattctttgcgaagcgg
cagttggtcactctgttttcagcgccaaactactgcggggagtttgacaatgccggtgga
atgatgagtgtggatgagtcactcatgtgctcttttcagatcctgaagccatcagaaaag
aaggcaaagtatcagtacagcggggtgaattcagggcgacctgtgaccccgccccgtact
gcccaagcccccaagaagaggtga

DBGET integrated database retrieval system