KEGG   Danio rerio (zebrafish): 100003223Help
Entry
100003223         CDS       T01004                                 

Gene name
ppp1cb, ik:tdsubc_2f2, si:zc214p16.4, wu:fa09h01, wu:fa11e06, xx:tdsubc_2f2
Definition
protein phosphatase 1, catalytic subunit, beta isoform (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dre  Danio rerio (zebrafish)
Pathway
mRNA surveillance pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100003223 (ppp1cb)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100003223 (ppp1cb)
  Cell growth and death
   04114 Oocyte meiosis
    100003223 (ppp1cb)
  Cellular commiunity
   04510 Focal adhesion
    100003223 (ppp1cb)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100003223 (ppp1cb)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100003223 (ppp1cb)
   04270 Vascular smooth muscle contraction
    100003223 (ppp1cb)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100003223 (ppp1cb)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100003223 (ppp1cb)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100003223 (ppp1cb)
Transcription machinery [BR:dre03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100003223 (ppp1cb)
Spliceosome [BR:dre03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100003223 (ppp1cb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
17
AA seq 327 aa AA seqDB search
MAEGELNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANNLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEK
KAKYQYSGVNSGRPVTPPRTAQAPKKR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcggagggggaattaaacgttgacagtctcatctctcgacttcttgaagtgcgagga
tgtcgtcctgggaagattgttcagatgacggaagcagaagttcgaggactctgcattaag
tctcgagagatcttcctcagccagcccatcctgctggagctggaggcgccacttaaaatc
tgtggtgacatccatgggcagtacacagatctgttgaggttgtttgaatatggtggtttt
ccaccggaggcaaacaatctctttctgggtgattatgtggaccgaggaaagcagtctttg
gagaccatctgcctcctgctggcctataagatcaaatacccagagaatttcttcctcctg
aggggaaaccatgagtgcgcctccatcaaccgtatctatggcttctatgatgagtgcaag
cgcaggttcaacatcaagctctggaagacattcacagactgctttaactgcctcccaatc
gctgccatcatagatgagaagattttctgttgccatggaggtctttctcctgatctgcag
tcaatggaacagatacgtcgaattatgcgaccaactgatgtcccagatacagggttgctg
tgtgatttgctgtggtcagaccccgataaggacgttcagggatggggagagaatgatcgt
ggtgtttcattcacgtttggtgctgatgtagtcagcaaattcctgaaccgccacgacctg
gacttaatctgtagggcacatcaggtggttgaggatggttatgaattctttgcgaagcgg
cagttggtcactctgttttcagcgccaaactactgcggggagtttgacaatgccggtgga
atgatgagtgtggatgagtcactcatgtgctcttttcagatcctgaagccatcagaaaag
aaggcaaagtatcagtacagcggggtgaattcagggcgacctgtgaccccgccccgtact
gcccaagcccccaagaagaggtga

DBGET integrated database retrieval system