KEGG   Danio rerio (zebrafish): 100003329Help
Entry
100003329         CDS       T01004                                 

Gene name
cacng8b
Definition
(RefSeq) voltage-dependent calcium channel gamma-4 subunit-like isoform X1
  KO
K04873  voltage-dependent calcium channel gamma-8
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04260  Cardiac muscle contraction
dre04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100003329 (cacng8b)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    100003329 (cacng8b)
   04261 Adrenergic signaling in cardiomyocytes
    100003329 (cacng8b)
Ion channels [BR:dre04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN gamma
   100003329 (cacng8b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 AA_permease_2 DUF2269 TctB CD20 TMEM173
Motif
Other DBs
NCBI-GeneID: 100003329
NCBI-ProteinID: XP_001342922
ZFIN: ZDB-GENE-100921-72
Ensembl: ENSDARG00000070626
Vega: OTTDARG00000033055
UniProt: E9QCW1
Position
16
AA seq 422 aa AA seqDB search
MVCEKGIQILLTIVGAFASFGLMTVAIGTDYWLYSRALICNSTANNTQEDPHNKDKKDPG
ALTHSGLWRICCLEGVKRGVCSQINHFPEDADFDHDGAEYVLRVVRASNIFPILSAILLL
MGGVCIAASRFYKSKRNIVLGAGILFVAAGLSNIIGVIVYISAALGDISPKKDEDKKWQY
SYGWSFYFGGLSFILAEMVGVLAVNIYIEKNKELRCRTRTDIFKSTTHAMLRLPSYRFRR
RSRSSSRSTDPSRSRDPSPVGGPPGGKNFGMPPSALLSQGPISVSTLPNPHSRSALPGGD
ISLYTLSRDPKLGGIGGLGAPPLYGTVDRATLYQLHNCFPKEGGGGMMMSGTLPSLKSHN
PSGVQNSSNSNAPLSNSVPSSQPPPFSSSTGERDRGMGTLDRLGKGDRESNSNTLNRKTT
PV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgtgagaagggcattcagatccttctcaccatcgtgggtgcattcgcatccttt
ggcctgatgacggtggctatcggcactgattactggctgtactcgcgggcgctcatctgc
aacagcaccgccaacaacacacaagaggacccccataataaggacaagaaggaccccggg
gccttgacgcactccggcctgtggaggatctgctgtctggagggggtgaagcgtggcgtg
tgctcgcagatcaaccacttcccagaggatgctgactttgatcatgatggagcagaatac
gtcctgagagtggttcgggcctccaacatctttcccatccttagtgccatcctgctgcta
atgggaggcgtctgtatcgcagccagtcgcttttacaagagcaaaaggaacatcgtgctg
ggagctggcattctgtttgtagccgcaggcctgagtaacatcatcggtgtgatcgtgtac
atctccgctgctctgggtgacatttctcccaaaaaggacgaagacaagaaatggcagtac
tcctacggctggtccttctacttcggcgggctctccttcatcctggcggagatggtgggg
gtccttgcggtgaacatctacattgagaagaacaaggagctgcgctgtcgcacccgcact
gacatcttcaagagcaccactcatgctatgctacgcctccccagctaccgattccgccgc
cggtctcgctccagctcccgctccaccgacccctcgcgctctcgagacccgtccccagtt
ggaggcccgccaggggggaagaacttcgggatgcccccatcagcgttactctcccagggg
cccatctccgtgtccacactacccaaccctcactcccgctcagctctgccagggggcgat
atttcactttacaccctctcccgtgaccccaaactgggaggtataggagggttgggcgcc
cctccgttgtatgggacggtggatcgcgccactttataccagctgcacaactgcttccct
aaggagggcggagggggcatgatgatgagcgggacgcttccctctctcaaatcccacaat
ccctcaggggtccagaattcttccaactccaatgctccgctaagcaactccgtcccgtcc
tctcaacctccacctttttcctcgtccacgggggagcgggatcgagggatgggaacactg
gataggctaggtaaaggtgacagagagagtaactccaacacactaaataggaaaaccaca
ccagtgtag

DBGET integrated database retrieval system