KEGG   Danio rerio (zebrafish): 100003397Help
Entry
100003397         CDS       T01004                                 

Gene name
rnasel2
Definition
(RefSeq) ribonuclease like 2 precursor
  KO
K01168  pancreatic ribonuclease [EC:3.1.27.5]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     100003397 (rnasel2)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic Type
  mRNA degradation factors
   Other degradation factors
    RNases
     100003397 (rnasel2)
Membrane trafficking [BR:dre04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100003397 (rnasel2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RnaseA Lambda_Bor
Motif
Other DBs
NCBI-GeneID: 100003397
NCBI-ProteinID: NP_001093575
ZFIN: ZDB-GENE-050208-420
Ensembl: ENSDARG00000043196
Vega: OTTDARG00000034828
UniProt: A5HAK1
Position
22
AA seq 150 aa AA seqDB search
MEILQSAVIFLLVFSFSFTVKVPDNESPYEKFLRQHVDPDMSVQKCNSEISKRKITAKAG
NDCKKVNTFIQANKRDVNAVCGNAGNRVVDTNLTKSNQPFPVVTCQLKSGERRPHCQYRG
RSSTRYIVLRCDKGWPVHYDEGIIDVNSSG
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggagattcttcagtctgccgtcatttttctgctggtcttcagcttctctttcacagtt
aaagtgccagataatgagtccccttatgaaaaattcctgaggcagcacgtggatcctgat
atgagtgtgcaaaaatgtaacagtgaaataagcaaaagaaaaatcactgccaaagctgga
aacgactgcaaaaaagtcaacaccttcatacaagcaaataaacgtgatgttaacgctgtt
tgtggcaatgcaggaaatcgggtggtcgacacgaacctgactaagagcaatcagcctttt
cctgtggtcacgtgtcaattaaaaagtggggagagacgcccgcattgtcaataccgtggt
agaagcagcacacgttatattgttttgcgttgtgataaaggctggcctgtacattacgat
gaaggcatcattgatgtaaacagctcaggctaa

DBGET integrated database retrieval system