KEGG   Danio rerio (zebrafish): 100003397Help
Entry
100003397         CDS       T01004                                 

Gene name
rnasel2, si:ch211-139g14.6
Definition
ribonuclease like 2
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     100003397 (rnasel2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
22
AA seq 150 aa AA seqDB search
MEILQSAVIFLLVFSFSFTVKVPDNESPYEKFLRQHVDPDMSVQKCNSEISKRKITAKAG
NDCKKVNTFIQANKRDVNAVCGNAGNRVVDTNLTKSNQPFPVVTCQLKSGERRPHCQYRG
RSSTRYIVLRCDKGWPVHYDEGIIDVNSSG
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggagattcttcagtctgccgtcatttttctgctggtcttcagcttctctttcacagtt
aaagtgccagataatgagtccccttatgaaaaattcctgaggcagcacgtggatcctgat
atgagtgtgcaaaaatgtaacagtgaaataagcaaaagaaaaatcactgccaaagctgga
aacgactgcaaaaaagtcaacaccttcatacaagcaaataaacgtgatgttaacgctgtt
tgtggcaatgcaggaaatcgggtggtcgacacgaacctgactaagagcaatcagcctttt
cctgtggtcacgtgtcaattaaaaagtggggagagacgcccgcattgtcaataccgtggt
agaagcagcacacgttatattgttttgcgttgtgataaaggctggcctgtacattacgat
gaaggcatcattgatgtaaacagctcaggctaa

DBGET integrated database retrieval system