KEGG   Danio rerio (zebrafish): 100003790Help
Entry
100003790         CDS       T01004                                 

Gene name
kat8, myst1, wu:fb22g02, wu:fj22d09, zgc:66387
Definition
K(lysine) acetyltransferase 8 (EC:2.3.1.48)
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 487 aa AA seqDB search
MNNSYENCGSEERMDVEIDSGHAGTDRGRLETGTRATCSSNGSGGEEDEMEAADREREAT
GSSTPRSADGVSLGGGREQEVSVEIGETYLCQRTDKTWHSAEVIQSRLNEQEGREEFYVH
YVGFNRRLDEWVGKARLALTKTVKDAVRKSVEEGGGGELVDQPERKITRNQKRKHDEINH
VQKTYAEMDPTTAALEKEHEAITKVKYVDKIQIGNFEIDAWYFSPFPEDYGKQPKLWICE
YCLKYMKYEKTFRYHLSQCQWRQPPGKEIYRKNNISVYEVDGKDHKIYCQNLCLLAKLFL
DHKTLYFDVEPFIFYILTEVNKQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKF
LIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSI
TQSDIISTLQPLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDTHCLKWAPPKHK
QAKFSKK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaacaattcatatgagaactgcggttcagaagagcgaatggatgttgaaatagactct
ggtcacgctggaacggaccgaggaagattggaaacgggaactcgagcaacatgttcatca
aacggcagcggcggggaagaggatgaaatggaggccgcggatcgagaacgagaagccacg
ggctcgagtactccgcgctccgctgacggagtgtcgcttggcggcggcagagagcaggag
gtgtcggtagagattggggagacttatctgtgtcagcgcacggacaaaacatggcattca
gcagaggttattcagtccagactgaatgagcaggagggcagagaagagttttatgtccac
tatgttggattcaatagacgtttagatgagtgggttggaaaggctcgtttggcgttgaca
aagactgtgaaagatgctgtgaggaagagtgtggaggaagggggtggaggagaacttgtg
gaccagccagagaggaagataacacgaaatcagaagaggaaacatgatgagatcaaccac
gttcagaagacttatgcagagatggaccccactacagcagccttggagaaagagcatgag
gcgatcacaaaagtaaaatatgtggacaaaatccaaattgggaactttgagattgatgcg
tggtacttttctccattcccggaggactatggaaaacagcccaagctttggatctgtgaa
tactgcctgaagtatatgaagtatgagaagaccttcagataccatctgtcacagtgtcag
tggcgccagcctccaggcaaagagatttatcgcaaaaataatatctctgtatatgaggtt
gatgggaaggaccataagatctactgtcagaatctgtgcctcctggcgaagctgtttctg
gatcacaaaacactttactttgatgttgagccattcatcttctacatcctcactgaagtt
aataaacagggagcgcatattgtgggttacttctccaaggaaaaagagtctccagatggg
aacaatgttgcttgtattctcacccttcctccatatcaacgacgaggatatggaaaattt
ctaattgcattcagttatgagttgtctaagctggaaagcacagtgggctctccagagaag
cctctgtcagacttgggaaagttgagttataggagttactggtcatgggtactactagag
attttgcgggacttcagagggacgctttccatcaaagaccttagtcagatgacgagcatc
actcagagtgacatcatcagcacactacagcctctgaacatggtcaagtactggaaaggt
cagcatgtcatctgtgtcactcccaaactcgtagaggaacatctgaaaagtgcccagtat
aagaaacctccaataacagtggacacacattgtttgaaatgggcacctccaaaacacaag
caggccaagttctccaaaaaatga

DBGET integrated database retrieval system