KEGG   Danio rerio (zebrafish): 100004382Help
Entry
100004382         CDS       T01004                                 

Gene name
qsox1, fk65c10, im:6793551, sb:cb840, si:dkey-39n1.2, wu:fc30g09, wu:fk65c10
Definition
quiescin Q6 sulfhydryl oxidase 1 (EC:1.8.3.2)
Orthology
K10758  
thiol oxidase [EC:1.8.3.2]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
8
AA seq 778 aa AA seqDB search
MARRGCGATSCYTTKTKLNSFYSFLCAFITCVSLCPVLCEAGLYTASDQVIVLTPENVDS
TLFNNTAALLVEFYATWCGHCIAFSPVWKSLARDIKEWKPAVDLAAIDCANESNRKVCTN
FGITGYPSIKFFHAYSSIGSRGLEVRGFSRDVRGLRQYIIENLELHTEAWPPACPPLETA
SEAEVHHFFPANNVKYLALVFENKKSYVGREVTLDLLQYENIAVRRVLDTETNLVSRFGV
TEFPSCYLYDSSGNITRLKVLKEARTFYSYALQRLPGVVRTGKHQTPITELIKNSTLQEW
RPFNKSRVYMSDLESALHYSLRVELSSHTSISGDDLIALKKYINVLAKYFPGRPSVKSAL
QAVDSWLQSQKGTEIKYSDFRDVLDNVVQTSDAVLPEGVQWVGCQGSQARYRGYPCAVWT
LFHVLTVQAKEMGSTVSEPQEVLLAMRGYVSSFFGCRPCATHFEAMAAESMDQVNSLSGA
VIWLWSRHNRVNNRLAGDLSEDPHFPKIQWPSPELCPSCHGVTIIGDHNWIKDEVPQFLQ
NYFSSSRILNDYLQDETQALIQQRNRLTAARMEKEAGRGADRRARDIFDNNPADEPQEEE
EEEEEEEPTFEEQAVEPYPAGLEGAPGADQAPWEKPQPLSSQRKPKIVGMKLREAQEDIV
DLDYFVSQHYKAKALRAAAMSGVVRRRSLQKKEDVEDLQFEGGWRVKRDLGSQEENFGIE
PYPRAQSKHWMSLLSVGFSRLDVSLCVLLYLLSTMCLLAMYMYFKLRIKLRSAKVSLP
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcgaggctgcggtgccacgtcttgttacacgacaaaaaccaagttaaactca
ttttactctttcctgtgcgcttttatcacttgtgtaagtctttgtcctgtactctgtgaa
gccgggctgtacacggcgtcggatcaggttattgttttaacaccggagaacgtagactcg
acgctgtttaacaacaccgcggctcttctcgtggagttttacgcgacctggtgcggacac
tgtatcgctttctcacccgtctggaaaagccttgccagagatattaaagaatggaagcct
gctgtggatctggctgctatcgattgtgctaatgaaagcaacagaaaagtgtgcaccaat
tttggcatcaccggatatccgtctattaagtttttccatgcttattcaagcattgggtcc
agggggcttgaggtcagaggattttcaagggatgtgagaggacttcgccaatacattatt
gagaatttggagctacataccgaggcttggccgccggcttgtccacctttagagacggct
agtgaggcagaggtacaccacttctttccggccaacaatgtgaagtatcttgctctcgtg
tttgagaataaaaagtcttacgtgggaagagaggtaacattggacttgttgcagtatgaa
aatatagctgtgcgcagggttttggacacagagacgaatttggtgtccaggtttggtgtg
actgaatttccttcctgttatctctacgactcctctggaaacatcactaggctaaaagta
ctcaaagaagctcgaaccttctactcgtacgccctccagaggctgccaggagtagtgcgg
actggaaaacaccaaactcccatcactgaactcatcaagaactccactctgcaggaatgg
aggccatttaacaagtcgcgtgtgtatatgtctgatctggagtcagcgcttcattactct
ctgcgtgtggagttatctagtcacaccagcatcagcggagacgatctgattgcactgaag
aagtacataaatgtgctggctaagtatttcccaggccgtccatctgtaaagagtgcatta
caggctgtggacagttggttacaatcacagaaggggaccgagatcaaatatagtgatttc
agagacgtcctggacaatgtcgtacagacgagcgacgcagtgctgcctgagggcgtgcag
tgggtgggctgtcagggatctcaggcccgatatcgtggatacccctgtgccgtttggacc
ctcttccatgtgcttacagtgcaggctaaagaaatgggaagcacagtctcagagcctcag
gaagtgctgctggctatgagaggttacgtcagcagttttttcggttgcaggccgtgcgca
actcactttgaggctatggccgcggagagcatggatcaggtcaactcgctgtctggcgct
gtcatttggttgtggtcacgccacaaccgagtcaacaaccgcctggcaggagacctcagc
gaggacccccatttccctaagattcagtggccctccccagaattgtgtccttcctgtcat
ggggtaacaattatcggagatcacaactggatcaaagatgaggtgccgcagttcctccag
aactacttttcctcatctcgcattctgaacgactacctgcaggacgagacccaggccctc
atccagcagagaaaccgcctcacagccgcccgcatggagaaagaagctggacgcggggca
gacaggagagcacgagacattttcgacaacaatcctgctgatgagcctcaggaagaagag
gaggaggaggaggaagaggaaccaacatttgaggagcaggcagttgagccgtatcctgcg
ggattagagggagcacccggagcagaccaggcaccatgggagaaaccacagcctttatca
tctcaacgcaagccaaaaattgtggggatgaagctccgggaggctcaggaggacatagta
gatctggattacttcgtcagccaacattataaagccaaagcccttcgagccgccgccatg
tctggtgtagtgcggcggaggagcctgcagaagaaggaggacgtggaagacctgcagttt
gaaggaggttggagggtgaagagagacttgggaagccaggaagagaatttcggaatagag
ccataccccagagcccaaagcaagcactggatgtccctgctcagtgtggggttctccaga
ctggatgtgagcctgtgtgtcctactgtacctcctgtccaccatgtgcttgctcgccatg
tacatgtattttaaactgaggataaagctgcgaagtgctaaagtgtctctaccttaa

DBGET integrated database retrieval system