KEGG   Danio rerio (zebrafish): 100004610Help
Entry
100004610         CDS       T01004                                 

Gene name
pop7
Definition
(RefSeq) ribonuclease P protein subunit p20
  KO
K14527  ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03008  Ribosome biogenesis in eukaryotes
dre03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100004610 (pop7)
   03008 Ribosome biogenesis in eukaryotes
    100004610 (pop7)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     100004610 (pop7)
Ribosome biogenesis [BR:dre03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     100004610 (pop7)
Transfer RNA biogenesis [BR:dre03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    100004610 (pop7)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    100004610 (pop7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rpp20 Alba
Motif
Other DBs
NCBI-GeneID: 100004610
NCBI-ProteinID: NP_001006004
ZFIN: ZDB-GENE-041010-88
Ensembl: ENSDARG00000036394
Vega: OTTDARG00000020115
UniProt: Q5XJ22
Position
7
AA seq 148 aa AA seqDB search
MAEPRSPVSASVPHNPIVLAAPEGSTLEMDPIEFTLRKRLPRKLPKRRNDVYVNMKTDFK
AQLARCQKLLDAHREICIHGLGLAINRAINIALQLQTSSQGALQLAANTSTVELIDDLEP
EDPDEAGEHLTRTRNNSAIHIKVFYPNP
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggctgagccacgaagcccggtgtccgcttctgtgccccacaatccaatagtcctggct
gcccccgagggctcgacccttgagatggacccaatagagttcaccctccgcaagcgactg
cctcgcaaactgcccaaacggaggaacgacgtctatgtcaacatgaagactgacttcaag
gctcagctagcgaggtgtcagaaacttctggacgctcacagggaaatctgcatccacggc
ctgggactggccatcaaccgggctataaacatcgctctgcagctccagacgtccagccag
ggcgccctgcaactcgccgcaaacacctccacggtggagctcatcgacgacctggagcct
gaagatccggacgaggccggagagcatctgacccgtacccggaataactcggccatccat
atcaaggtgttttaccccaatccgtag

DBGET integrated database retrieval system