KEGG   Danio rerio (zebrafish): 100005446Help
Entry
100005446         CDS       T01004                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like
  KO
K03173  
TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
RIG-I-like receptor signaling pathway
Adipocytokine signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100005446
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100005446
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100005446
  Endocrine system
   04920 Adipocytokine signaling pathway
    100005446
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100005446
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100005446
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100005446
Ubiquitin system [BR:dre04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100005446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
5
AA seq 584 aa AA seqDB search
MAAQEPSPPSSMENNKPGFPKKILANKLEDKHLCNCCQNILRRPFQAQCGHRFCSYCFNR
TVGSGPQKCNACIKEDIFEEPTSILKQGCAFPDNAARREVENLPAVCFNEGCSWKGSIKD
YELSHEGKCEFMILPCPLCKELIRFNEQERHNERECPERTLNCKYCKEPFHFKNIKAHDE
ICPKYPMICEGCAKKKIPREKYVDHIKFCSKFRTPCRYHVVGCDMLVEKEKIHEHERACA
HEHLNLLLHYIMGMKVSLEGLQPQSLDLAGHKAHELHQALRDLETRVSQLSGAPVQGVPS
SSSSSSASSSAAPPPPAPTATLPTSFTPLPSSVGAALELQLHSEKTKVADLGRRCQDLEV
KAGTFEDVVCVLNREVERFATTMEASNRQHRLDQDKIEALSNKVRQLERQVGVKDLTVAE
MEGRLREMSATTFDGVFIWRISDFTKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLN
GDGTGRGTHLSLFFVVMRGMSDALLKWPFNQKVTLMLLDQSNREHIIDAFRPDITSSSFQ
RPVSEMNIASGCPLFCPLAKLEGKNSYIRDDTIFIKAIVDLTGL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcaagaaccctctcctccgtcctccatggagaacaacaagccagggttcccg
aagaagattctggccaacaaacttgaagataaacatttatgcaactgctgtcagaacatt
ctgaggagaccgttccaagctcagtgcggccatcgcttttgctcttactgcttcaaccgg
actgttggatctggaccacagaaatgtaatgcctgcatcaaagaggacatcttcgaagag
cccacgtcaatcctcaaacaaggctgcgcgtttcccgacaatgctgccagaagagaagtt
gaaaatcttccagccgtgtgcttcaatgagggctgctcctggaaaggcagcattaaagac
tatgagttaagccacgaggggaagtgtgagttcatgattctgccctgtcccttgtgcaag
gagcttattagatttaatgaacaggaacgtcacaacgaacgcgagtgtcccgagagaaca
ctcaactgcaaatactgtaaagaaccgtttcacttcaaaaacatcaaggcccacgatgag
atctgtcccaaatatcctatgatttgtgaaggatgtgcgaagaagaaaatccccagggaa
aagtatgttgaccacatcaagttctgcagcaaattcaggactccatgcagatatcatgtg
gttggctgtgacatgttagtggagaaggagaaaatccacgagcatgagcgcgcctgtgcc
cacgagcacctgaacctgctgctgcactacatcatgggtatgaaggtcagcctggagggt
ctgcagccccagagcctggatctggcgggccacaaagcacacgagctgcaccaggcgctg
cgggacctggagacacgggtcagtcagttaagtggagctcccgtgcagggggtcccgtcc
tcgtcatcttcctcctctgcctcttcatccgccgctccgcctccgcctgctcccaccgcc
acgctgcccacctccttcactcctctgcccagctcagtgggtgctgctctggaattgcag
ctccatagcgagaagaccaaggtggcggacctgggccggcgctgtcaggacctggaagtg
aaggccgggacgtttgaggacgttgtgtgtgtgctgaatcgagaggtggagcgcttcgcc
accaccatggaggccagcaaccgacagcacagactcgaccaggacaaaatagaggcactc
agcaacaaggtacgtcaactggagcgtcaggttggtgttaaagacctgactgtagcagaa
atggagggccgactgagagaaatgtctgcaaccacgtttgacggcgtcttcatctggagg
atttcagacttcaccaaaaagagacaagacgccattgctggacgagcacctgccatgttt
tcacctgcattttacacaagtaagtacggctataagatgtgcctgcgcatttacctgaac
ggggacgggacggggcgcgggacgcacctctcgctgttctttgtggtcatgagagggatg
agcgacgcgctgctcaaatggcccttcaaccagaaggtgactctgatgctgttggaccag
agtaaccgagagcacatcattgacgcctttcgtcctgacatcacgtcctcctcgtttcag
cggcctgtcagcgagatgaacatcgccagcggctgcccactcttctgccccctcgccaag
ctggagggcaagaactcctatatccgggacgacaccatcttcatcaaagccatcgtggac
ctgaccggcctctag

DBGET integrated database retrieval system