KEGG   Danio rerio (zebrafish): 100005704Help
Entry
100005704         CDS       T01004                                 

Definition
uncharacterized LOC100005704
Orthology
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100005704
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     100005704
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     100005704
Glycosyltransferases [BR:dre01003]
 Glycan extension
  ABO blood group
   100005704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 288 aa AA seqDB search
MAQFQYKQPSLLAGRADVVSLSPWLAPIIWEGTFNPTLIDSIYKQHNITIATTVFALGKY
TRFLKDFLESAEEHYFVGFGVHYYLFTDQPEAVPEVKMGKNHRLTVRKVPSLDRWQDISM
GRMEILEKLIADELMHEANYIFCLDVDTKFYGRWGSETLGNLVGVIHPWLFDYPRESFTY
ERRPESKAFIPVGEGDYYYTAAAFGGTLEEIHRLTKTCREQLNADHENSIEAIWHEESHL
NKYFLYNKPTKLLSPEYLWRDINISAGQIKIIRFSHVAKNNAEVRPNA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtttcagtacaaacagcccagtttgctagcaggtcgggcagatgttgtttct
ttatcaccatggctagcccctatcatttgggagggaacctttaaccccacgctgattgat
tctatctacaagcaacataacatcaccattgccaccactgtcttcgctttgggaaaatac
acgcgttttctcaaagattttctggagtcagcggaggagcattactttgttggatttgga
gtccattattacctgttcacggatcagcctgaagcagttcctgaagtaaagatgggtaaa
aaccatcgtttgacagtcagaaaggtcccaagtttggaccgatggcaggacataagtatg
ggcaggatggagatactggaaaaactaatagcggatgaactgatgcatgaagccaactat
atattctgccttgacgtggatacgaagttctatggccgctggggatcagagactttgggt
aatctggtaggtgtgattcacccttggctttttgattatccaagggaatcatttacatac
gagcgaagaccagagtctaaagcatttattccggttggggaaggggattattattacact
gctgctgcatttggtggcacattagaggaaatacatcgtctcaccaaaacctgccgcgag
cagctgaacgctgatcatgaaaactccattgaggcaatatggcatgaggagtctcactta
aacaagtatttcctttacaacaaacccactaagctgctgtcacctgagtatctgtggcgg
gacatcaacataagtgcaggacaaataaaaattattcgcttctctcatgtggctaaaaac
aatgcagaggttcgtccaaatgcatga

DBGET integrated database retrieval system