KEGG   Danio rerio (zebrafish): 100005716Help
Entry
100005716         CDS       T01004                                 

Gene name
pcsk1
Definition
proprotein convertase subtilisin/kexin type 1 (EC:3.4.21.93)
Orthology
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     100005716 (pcsk1)
Peptidases [BR:dre01002]
 Serine Peptidases
  Family S8: subtilisin family
   100005716 (pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
21
AA seq 755 aa AA seqDB search
MEERCRPMLLCSVLALVCALVSSAVDRQYLNEWAVEIPGGVQNARSIADEFGYQLVRQIG
ALENHYLFKRHSHPSRTKRSADHITKRLSEDDRVSWAEQQYEKRRAKRAPLGVECKDCSV
DKLFDDPMWNQQWYLQDTRTSSSLPKLDLHVIPVWKKGITGKGVVITVLDDGLEWNHTDI
YPNYDPAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNSKVGG
IRMLDGIVTDAIEASSIGYNPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQKGRG
GKGSIFVWASGNGGRQGDNCDCDGYTDSLYTISISSASQQGLSPWYAEKCSSTLATAYSS
GDYTDQRITSADLHNECTETHTGTSASAPLAAGIFALALEQNPDLTWRDLQHLVVWTSEF
DPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPKVWKHVPEKKQCIVRDETFQPR
PLKAAGEISIEIPTKACAGQANSVMSLEHVQVEVSIEYTRRGDLHITLTSPSGTTTVLLA
ERERDTSSNGFRNWAFMSVHTWGENPTGTWILKITDTSGRMENEGQIISWKLILHGTSEK
PEHMKKARVYTPYNAVQNDRRGVEPMEDMMKQEAPTPALKPEIPNQAIPDSPPSTASMSI
PEVNSGPSTANLALLRLLQSAFNRQMPAAPPKSFQQERIPPQKLYQALDLLNRYRASQNG
LFNDYSDNFYRAQPYRHRDDRLLQALFDMLRDDQQ
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagatgtcgtccaatgttgctgtgcagtgttcttgctctggtgtgtgcgctc
gtgtcttcagccgtggacaggcagtatctcaacgaatgggcggtggagattcctggagga
gtccaaaatgcacgatccatcgccgacgagttcggataccaattagtccgacagattggg
gcgctggaaaaccattatttattcaagcggcacagtcaccctagcaggaccaaacggagt
gcagatcatatcaccaaacgtctgtcggaagatgacagggtgtcttgggccgaacagcag
tatgagaaacggagggctaagcgggcgccgctgggggtcgaatgtaaggactgttcagtg
gacaaactcttcgacgaccccatgtggaaccagcagtggtatctgcaagacacccggaca
tcatcatcccttcccaaactagacctgcatgtgatccccgtctggaagaagggcatcacg
ggaaaaggagtggtcattactgtactggatgacggtctggagtggaaccacaccgacatt
tatccaaactacgatcctgctgctagctatgactttaacgacaacgatccggatcccttc
cccagatacgactccaccaatgaaaacaagcatggtaccagatgtgctggagagattgcc
atgcaagcagacaacaacaaatgtggcgttggagtggcctacaactcgaaagtgggaggg
atacgaatgctggatggaatcgtgactgatgccattgaagccagttccattggttataac
cctgaccatgtggacatctacagtgctagctggggtcctaatgatgatgggaagactgtg
gaggggcctggacgccttgcccagaaagcttttgagtacggtattcagaaggggcgtggt
ggtaaaggctccatttttgtgtgggcgtctggtaacgggggtcgacagggcgataactgt
gactgtgatggatacacagacagtctgtacaccatctccatcagcagcgcatcccagcag
ggtttgtccccgtggtacgctgagaaatgctcctccacgctggccacggcctacagcagc
ggagactacaccgaccagagaataactagtgctgatttgcacaatgaatgcacagagaca
cacactggcacatctgcatctgccccactggctgctgggatatttgcactggctttggag
caaaatcccgatctgacatggcgggaccttcagcacttggtggtttggacgtctgagttt
gaccctctcgccaataaccccggctggaaaaggaacggagctggactgatggtcaacagt
cgttttgggtttggtctcctgaatgccaaagccctggtggacctggccgatcctaaagtc
tggaaacacgttcccgagaagaaacagtgcatcgtcagagatgagacgtttcaaccaaga
ccattgaaggctgcgggcgagatctccattgagatccccactaaagcctgtgcaggacag
gcaaattctgtcatgtccttggagcatgtgcaggtggaggtgagcattgagtatacaaga
agaggagacctccacatcacactcacatctccatcaggtaccactacagtcctactggcg
gagagagagagggacacttcatctaatggtttccgaaactgggccttcatgtctgtgcac
acatggggagagaatcccactggcacttggatcctgaagatcactgatacgtcaggacgg
atggagaatgagggtcagatcatcagctggaagttaattttgcacgggacgtctgagaag
cctgaacacatgaagaaggcgagagtatacacaccgtacaacgccgtacaaaatgatcgc
agaggagtggagccgatggaagacatgatgaagcaggaagctccaactccagctctcaaa
cctgagattccaaatcaagcgatcccagactctccgccttccactgcctccatgagcatc
ccagaagtaaactccggcccgtccactgccaacctggccctgctgcgtctccttcagtca
gccttcaacaggcagatgccggcggctcccccgaagagcttccagcaggagcgcatcccg
ccacagaagctgtatcaggccctagacctgctgaaccgctacagggcctcccaaaacggc
ctgttcaatgactacagcgacaacttctacagagcccagccgtacagacacagagacgac
cggctgctgcaggctctgttcgacatgctccgggacgaccagcagtga

DBGET integrated database retrieval system