KEGG   Danio rerio (zebrafish): 100007679Help
Entry
100007679         CDS       T01004                                 

Gene name
map2k5
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 5
  KO
K04463  mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04540  Gap junction
Module
dre_M00690  MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100007679 (map2k5)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100007679 (map2k5)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100007679 (map2k5)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: STE group
  STE7 family
   100007679 (map2k5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PB1 Haspin_kinase Kinase-like Seadorna_VP7 SF3b1
Motif
Other DBs
NCBI-GeneID: 100007679
NCBI-ProteinID: NP_001107789
ZFIN: ZDB-GENE-030131-1517
Ensembl: ENSDARG00000011851
Vega: OTTDARG00000035343
UniProt: A9JRD0
Position
7
AA seq 450 aa AA seqDB search
MLLLVLSNLSNMESEGIVIRIKTPVGDMDSPVDSPSHLNFNDLLAAIRDAMPEATVTAFE
YEDEVGDRITVRSDDELKAMLSYYCNTVMEQRFNGLLPEPLQIFPRAGKTPGIRNIHGLK
VNTRPESSSGRSSSAADSRSSDSSLKKSSAELKKILTNGQINEHDLQYQEQLGHGNGGTV
YKAYHLLGKRIVAVKVIPLDITVELQKQIMSELEILYKCDSPYIIKFYSAFFVENRISIC
TEFMDGGSLDVYWRIPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSVGISFMELALGSFPYPQIQ
KNQGSLMPLQLLQCIVDEDPPVLPVGQFSEKFVHFITQCMRKLPKERPAPNNLMDHPFIV
QYNDGNTEVVSMWVCRSLEDRKAQQPQRLM
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcttttacttgttttgagtaacctgagcaatatggaatctgagggaatcgtcatccgg
ataaagacgccggtgggggacatggactcgccagtggacagtccatcacatctcaacttc
aatgatttgctggccgcgatcagagatgccatgcctgaagccacagtcacagcatttgag
tatgaggatgaagttggtgaccgaatcacagttcgcagtgatgacgagctcaaagccatg
ctgtcctattactgcaatacagtgatggagcaacgcttcaatggactgttacctgagcct
ttacagatatttccacgagccggtaagaccccagggatccgcaacattcacggcctgaag
gtgaacacgcggcccgaatcctcgagtggcaggagctcctctgcagctgattcccgctcc
agcgatagcagtttaaagaagtcttcagcggagcttaaaaagatcttgacaaatgggcag
ataaatgaacatgacctccagtaccaggaacagcttggccatggaaatggtggaacagtt
tacaaagcctatcacctacttgggaaaagaatagtggcagtaaaggttattcctcttgac
atcacagtggagctgcagaagcagatcatgtcagagcttgagatactttataagtgtgat
tctccgtacatcataaagttctacagtgctttctttgtggagaacagaatatcgatatgc
actgagtttatggatggtggctctctggatgtatattggagaatcccagagcatgttttg
ggcaggattgctgttgcggtggtaaaaggattaacgtacctctggagcctgaagatttta
cacagagatgtcaaaccatccaacatgctggtcaacacacgaggtcaagtcaaactttgc
gactttggagtcagcacacagttggtgaattccattgcaaaaacgtatgtcggaaccaac
gcatacatggcgccagagcggatatctggggaacagtatggtattcactctgacgtgtgg
agcgtagggatctctttcatggagttggctctgggctcttttccatatccacagattcaa
aagaaccagggctctttaatgcctcttcagttattgcagtgcattgttgatgaggatccc
cctgtacttccagttggtcagttcagtgagaaatttgtccacttcattacacaatgtatg
aggaagctgcccaaagaaagaccagctccaaacaacctgatggaccacccatttattgtg
caatataatgatggcaacactgaggtggtgtccatgtgggtgtgccgcagcctagaggac
cgcaaagcccagcagccacagagactcatgtga

DBGET integrated database retrieval system