KEGG   Danio rerio (zebrafish): 100034366Help
Entry
100034366         CDS       T01004                                 

Gene name
cyp2p8, cyp2j23, si:dkey-183n20.5
Definition
cytochrome P450, family 2, subfamily P, polypeptide 8
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100034366 (cyp2p8)
   00591 Linoleic acid metabolism
    100034366 (cyp2p8)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100034366 (cyp2p8)
Cytochrome P450 [BR:dre00199]
 Cytochrome P450, animal type
  CYP2 family
   100034366 (cyp2p8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 496 aa AA seqDB search
MDLWYLYEWIDIKSILIFLCVFLLLGDYIKNKAPKNFPPGPWSLPIIGDLHHIDNSKIHL
QFTKFAERYGNIFSFRLFGPRIVVLNGYNLVKEVYIKQGDNLADRPVLPLFYEIVGDKGL
ILSSGYKWKHQRRFALSTLRNFGLGKKSLEPSINVECGFLNEAISNEQGRPFDPRLLLNN
AVSNVICVLVFGNRFDYSDHHFQTLLKNISEAVYLEGSICNQLYNMFPWLMERLPGPHKT
IITLWRKVTDFVREKVNEHRVDYDPSNPRDYIDCFLTEMEKLKDDTAAGFDVENLCICSL
DLFVAGTETTSTTLYWGLLYMIKYPEIQAKVQEEIDAVVGGSRQPSVSDRDNMPYTNAVI
HEIQRMGNIAPINLARSTSEDTQIGNYSIPKGTMVTSNLTSVLFDESEWETPHSFNPGHF
LDAEGKFRRRDAFLPFSLGKRVCLGEQLARMELFLFFSSLLQRFTFSPPAGVEPSLDYKM
GGTHCPKPFKLCAVPR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggacttgtggtacctttacgagtggatcgatatcaaaagtattttgatatttctgtgt
gtgtttttattgctgggtgattatataaaaaataaagcaccaaagaactttcctcctgga
ccctggtctttgccgataataggagatcttcatcatatcgataatagtaagattcatctt
cagttcacaaagtttgcagaaagatatggcaatattttcagctttagactttttggacca
agaattgtggtgttgaacgggtataacttggtcaaagaggtgtatataaaacaaggagac
aacctcgctgatcgaccagtgttaccactattttatgaaatcgttggagacaaaggttta
attctttccagcggatataaatggaagcatcagaggagatttgcactctcgactcttcga
aatttcggattggggaagaaaagcctggagccatctatcaatgttgaatgtggctttctg
aatgaggccatctcaaatgaacaaggtcgaccctttgaccctcgcttacttctgaacaat
gctgtctcaaatgtgatctgcgtgctggtgtttggtaatcgatttgactacagtgaccat
cacttccagactctgctgaagaacatcagtgaagctgtgtatctggaaggaagcatctgc
aatcaactttacaacatgttcccatggctcatggagcgactgcctggaccacataagaca
attattactctgtggcggaaggtgactgactttgttcgagagaaggtgaatgaacacaga
gtggattatgatccatcaaatcctcgagactacattgactgctttctaactgagatggaa
aagctcaaagacgacacagctgcagggtttgatgtggagaacttgtgcatctgttctctg
gatctgtttgtagcaggaactgagaccacctccaccactctgtactggggtcttctctac
atgataaaatatcctgagatacaagctaaagttcaggaggagattgatgccgttgttgga
ggctcaaggcagccatctgtatcagacagagacaacatgccctacaccaatgctgtcatt
catgagatacaaaggatgggaaatatagccccaataaatctggccaggagtacttcagaa
gacacccagataggaaattactctattccaaagggcacaatggtgaccagtaatttgaca
tcagtgctgtttgatgagtctgagtgggagacgcctcactcttttaacccgggtcacttc
ctggatgctgagggcaaattcaggaggagagatgcctttttacctttttctctaggaaag
agagtgtgtcttggggagcagttggcgaggatggagctcttcctcttcttttcctctctg
ctgcagcgcttcactttctctccaccagcgggtgtggagcccagcctggattataaaatg
gggggcacacactgtcctaagccatttaaactgtgtgcagttccacgctaa

DBGET integrated database retrieval system