KEGG   Danio rerio (zebrafish): 100037349Help
Entry
100037349         CDS       T01004                                 

Gene name
mlycd, zgc:162977
Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
dre  Danio rerio (zebrafish)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100037349 (mlycd)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100037349 (mlycd)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100037349 (mlycd)
Enzymes [BR:dre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     100037349 (mlycd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
18
AA seq 504 aa AA seqDB search
MTPFHLSTVARSLLKSYRHRAVLKTIHGLRLWDFQSMHPRSSIAGHELMEEILRKTVAPL
PSYEMRDKSPPPPESNSLEFMHFYKSLEKEQRLEFLEKLSHDFGVDHRWASDLAAKLLEA
QVRDVATILQVEDRLRYSLTPRYRQLLTHISRVQGGVKFLVDLRADLIEFASSKISDSPH
MRDLNSTLKALLSEWFSVGLLRLERITWQSPCEILQKISQYEAVHPVRNWTDLKRRVGPN
RRCYAFTHASMPGEPLVVLHVALTEDIANNIQGIVREFATLDADEDVNKINAAIFYSISS
TQAGLQGVELGNYLIKRVVRELQSEFPHMAQFSSLSPIPGFSLWLQGALGQHKKEGRATE
LLSEQEWREVEDVTGAAPGAPALEALRRLISTSEWIHSDRLVRALEPALMRLCAWYLFGE
KRRGYALNPVANFHLQNGATMWRLNWQADTSPRGIANSCGIMVNYRYFLQETGTNSIAYL
HNKVIKASEQVLGLVSQFQRNSKL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacacctttccacttaagtacagtcgcgcgatctttgctaaagtcttatcgacacaga
gctgtactaaaaacaatccacggactccgactctgggattttcaaagcatgcatccacgc
tcctccatcgcagggcacgaactcatggaggagatcctgaggaagactgtggccccattg
cccagctacgagatgagagacaaatctccacctccacccgaatccaacagtttggagttc
atgcatttttacaaaagtttagagaaagagcagaggctggagttcctcgagaagttgtct
catgatttcggggttgatcacagatgggcttcggatctggccgcaaagttgctggaggct
caggtgcgggatgtggccaccatcctgcaggtggaggacaggctacggtacagtttgaca
ccccggtaccgacagctgctcacccacatcagcagggtgcagggcggggtgaagtttctg
gtggacctcagggcagatctcatcgagttcgcatcctcaaaaattagtgacagcccacat
atgagggacctgaacagcactctgaaggctcttctgtctgaatggttctctgttgggctc
ctccgacttgaaagaatcacttggcagtccccatgcgaaatccttcagaagatcagccag
tacgaagcggtgcaccctgtgagaaactggacagatctgaagcgcagagtagggccaaac
cggaggtgttacgcctttacccacgcatccatgcccggagaaccactggtggtgctgcat
gttgccttaactgaggacatagcaaataatatccagggcattgtgagagagtttgccact
cttgatgcagatgaggatgtgaataaaatcaacgccgccatcttctactccatctcttcc
acccaggccggactgcagggggtggagctgggcaattacctgatcaagagggtggtccga
gaactacagagcgagtttccacacatggcccagttctccagtctgtctccgatccctggc
ttctccttatggctccaaggggctttgggacagcacaagaaggagggtcgagccacagag
ctcctctctgagcaggagtggcgggaagtggaggacgtgacgggagctgctcctggtgcc
ccggctctggaggccctgcgcagactcatcagcaccagcgagtggattcactctgaccgt
ctggttcgtgctttggagcctgcgctcatgcggctctgtgcttggtatctgtttggtgaa
aaacgacgagggtacgctctcaaccccgtagccaactttcaccttcagaacggcgccacc
atgtggaggctaaactggcaagccgatacaagcccaagaggaatcgccaactcctgtgga
ataatggtcaattatcgctactttttgcaagagactggcactaacagcatcgcttacctg
cacaataaagtcatcaaggcctcggagcaggtgctgggactggtgtcacaatttcagagg
aacagcaaactctga

DBGET integrated database retrieval system