KEGG   Danio rerio (zebrafish): 100037356Help
Entry
100037356         CDS       T01004                                 

Gene name
bdh1, zgc:163053
Definition
3-hydroxybutyrate dehydrogenase, type 1 (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
dre  Danio rerio (zebrafish)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100037356 (bdh1)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    100037356 (bdh1)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     100037356 (bdh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
24
AA seq 359 aa AA seqDB search
MASLPMVRVALLVAFSVFLTLVLGFGLPSVLNWIARCCGFPEASVTECIVFVYALFVLYV
AVPRLPRGTVEVEGKALLITGCDTGFGPALAKHFHKLGFTVFAGCLFKDGEGAKELENIH
SEKLKVVQLDVCSEEQVSQAVQFVTENLPDSEKGLWGVVNNAGISTFGEVEFTTMDTYKQ
VSEVNLWGTIRVTKAFLPLIRRAKGRVVNIASMYGRMGNALRSPYCISKYGVEAFSDCLR
YEMKTWGVKVSIIEPGNFIVATGILTRDIVTTTAEKLWKEAPPIVQEDYGKAHFEQYMAL
MRSYCNSGQREIEPVLDDITDAIMSQRPYTRYSPMEPHWWIRIQIMTHLPGAISDRLYF
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgctgccgatggtgagagtggcgctgctcgtcgctttctcggtgtttttgacg
ctcgtgttaggattcggtttgccgtcggtcctcaactggatcgcccggtgctgcggcttc
ccggaggcgagtgtcaccgagtgcatcgtgttcgtgtacgcgctcttcgtgctgtacgtg
gccgtgcctcgactcccccgcgggacggtcgaggtcgaagggaaagcgctgctcattacc
ggctgtgacactggattcggacccgctttggccaaacacttccataagctgggcttcact
gtgtttgcaggttgtctgtttaaggatggagaaggagcaaaggagctggagaacattcac
tcagagaagctgaaggtggtgcagctggatgtctgcagtgaggagcaggtctctcaggct
gttcagtttgtgactgaaaacctgccagactcagagaaaggtctgtggggtgttgtcaat
aacgcgggtatctccacattcggggaggtggagttcaccaccatggacacttacaagcag
gtgtcagaagtgaacctgtggggaaccatcagagtcaccaaagcctttctgccactcatc
cgcagagccaaaggtcgtgtggtgaacatcgccagcatgtacggccgaatgggaaacgct
ctccgctcgccgtactgtatttccaaatacggagttgaagctttttcagactgtctgcga
tacgaaatgaagacgtggggcgtcaaagtttccatcattgaacccggaaacttcatcgtt
gccacagggatcctaacacgcgacatcgtcacaacaacggccgagaagctctggaaggag
gcgccccctattgtccaggaggattatgggaaggctcattttgagcagtacatggctcta
atgcgctcctactgcaacagcggccagcgcgagatcgaaccagtgctagacgacatcaca
gacgccatcatgtcccagcggccatacaccagatacagcccaatggagccacactggtgg
atccgcatccagatcatgacgcatcttcctggagccatttcagacagactctacttctga

DBGET integrated database retrieval system