KEGG   Danio rerio (zebrafish): 100048921Help
Entry
100048921         CDS       T01004                                 

Gene name
flnca
Definition
(RefSeq) filamin C, gamma a (actin binding protein 280)
  KO
K04437  
filamin
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100048921 (flnca)
 Cellular Processes
  Cellular community
   04510 Focal adhesion
    100048921 (flnca)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100048921 (flnca)
Cytoskeleton proteins [BR:dre04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100048921 (flnca)
  Intermediate filaments
   Intermediate filament-binding proteins
    100048921 (flnca)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100048921 (flnca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
25
AA seq 2702 aa AA seqDB search
MSNYTHLDDLPPQYYQGTDLGEEEEEEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
NKGVTDLQKDLGDGLKLISLLEVLSQKKMYRKHHVRPNFRQMKLENVSVALEFLDRERIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDDEDDEEVKKLTPKQRLLGWIQNKV
PELPINNFNKDWRDGKALGALVDNCAPGLCPDWQTWDPNQPVENAREAMQQADDWLGVPQ
VIAPEEIVDPDVDEHSVMTYLSQFPKAKLKPGAPVKPKQLYPKKAKAYGPGIEPQGNMVL
KPAVFTVETLEAGLGEVIVYVEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVL
FAGQDIDKSPFMVNVAKALGDPNKVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGDVSVV
IVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEASN
ANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGGVEVPVKVCDVGDGVF
KCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVSKEAGTQKVRAWGPGLKTGMVGKSADFV
VEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSP
FMAHILPAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAREAGKGGLKIYAQDAEGCV
IDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLVGEGCHPDKVKVYGPG
VEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKY
TPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTIF
TKGAGKAKPEVHFKTAAKGNAVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPK
SPFKITVAPSLDLGKVKVQGLNEKVEVGKDQEFIVNTKGAGGQGKVNVSITSPSGRPIPC
KLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPADPSKVRAYGPGLK
GGIVGQPAKFSIDTKGAGAGGLGLTLEGPCEAKIECQDNGDGTCSVVYLPTEAGDYNINI
LYGEAHIPGSPFKAVVKPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEIV
SDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSGI
KVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTY
RVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLEGGIVNKPNCFT
VETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSP
FRVQVKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVV
VKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGLDTT
GVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTI
TIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVAESLGPNIQMSEETVITVDAKA
AGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQV
MATDQPVAPRDDTKPMFQPLNLVIPFTVQQGELSGEVRMPSGKTARPFIRDNKDGTVTVQ
FQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPGLCHGTVNKPASFTVVTK
NAGQGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAK
ITGDDSLRRSQLNVGTAADVSLKITETDLSYLTASIKAPSGKEEPCLLKRLPNRHIGLSF
TPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVD
TRNAGYGGLGLSIEGPSKVDINCDDVEDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFT
VKVTGEGRMKQSITRKRQAASIASVGSTCDLNLKIPGNWFQMLSAQERLTRTFTRSSHTY
TRTERTEISKTHGGETKREVHVEESTQVGGGGGDPFRDVFESFLGRDRLGSFGTIRQEGE
TGIQGMTAQVTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQF
TVGPLGEGGFHKVRAGGTGLERAVAKVPAEFSIWTREAGAGGLSIAVEGPSKAEINFEDR
KDGSCGVSYVVQEPGDYEVSIKFNNEHIPDSPFIVPVATLSDDARRLTVTSLQEKDLKVN
QEASFAVQRNGARGVIDAKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDVKFNG
SHIPGSPFKVRVGEAESVGDPGMVSAFGPGLEGGRTGVPSEFVVNTCKAGSGALSVTIDG
PSKVKMDCNECQEGYKISYTPMAPGNYLICIKYGGPQHIVGSPFKAKVIGMRLSGGHSLH
ETSSVIVETVTKSSKMAGAYSSLTSSMPTSDASKVVCHGAGLSKAFVGQKNSFSVDCSKA
GTNMLMVGVHGPRTPCEDVTVKHMGNKLYNVTYTVKEKGNYVVIVKWGDETIPGSPFHVS
AP
NT seq 8109 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattacacacatttagacgacctgccgccgcagtattaccaaggcacagacctt
ggagaagaggaagaggaggagatgccggcgaccgagaaagacctggccgaggacgcgccg
tggaagaagatccaacagaacaccttcaccaggtggtgcaatgaacacctcaaatgcgtt
aataagggcgtcactgacctgcagaaagacctgggcgatggcctcaaactcatctcgctt
ttggaagtcctcagtcagaagaaaatgtacagaaaacatcacgtcaggccaaacttcaga
cagatgaagctggagaacgtgtcggtggcgctggagtttctggacagggagagaatcaaa
ctggtgtcaatagacagcaaagccattgtagacgggaacctgaagctgattctgggtctc
atctggacgcttattctccattattccatctccatgcccatgtgggatgatgaggacgac
gaggaggttaagaaactgactcccaaacagagattgctgggctggattcagaacaaagtg
ccagagctgcctattaacaacttcaacaaggactggagggatggcaaggctcttggcgcc
ctagtggacaactgtgcccctggtctgtgccctgactggcaaacatgggaccccaaccag
ccagtggaaaatgctcgtgaggccatgcagcaggccgatgactggctcggagtgccacag
gtgattgctccagaggaaattgtggatccagatgtggatgagcattcagtgatgacatac
ctctctcagtttcccaaagctaaactgaagcctggagcccctgttaagccaaagcagctg
taccccaaaaaggccaaggcctatggaccaggtattgagcctcaggggaacatggttctg
aaaccagcagtatttactgttgaaacactggaggctggactcggtgaagtgattgtatat
gtagaagacccagagggtcacactgaggaggccaaagttgttgccaacaatgacaagaaa
aggacattctctgtcacctatgtgcctaaggttgagggacgtcacaaggtgaaggtactc
tttgctggtcaggacattgataagagcccattcatggtgaatgtggcgaaggctctgggt
gatcctaataaagttcaagctcgaggtccaggtttggagccggagggcaatgtggcccac
aaacctacctattttgacatctacactgcaggtgctggggctggagatgttagcgtggtc
attgtggacccgcagaataaaaacaacactgtggaagttatccttgaaaacaagggtgat
aacatcttccgctgcacctacaaacctgtgctggagggaccacacaccatccatgtgacc
tttgctgggcagcctattcccagcagcccttttaaagtgaacatctctgaggccagcaat
gccaatgcctgccgtgcaactggcagaggactacagcctaaaggtgttcgggttaaggaa
gtggcggatttcacagtttttaccaaaggagcaggaactggggagctgaaggtgtctgtg
aaagggcctggtggagtagaggtgcctgtgaaagtgtgtgatgttggtgatggagtgttc
aagtgtgactattgtcctgttaagcctggaaaatatactgtgaacatcacatggggagga
caacctatcccacgcagcccatttgaggtagaggtcagcaaggaagctggaacccaaaag
gtgcgagcttggggtcctggcttgaagactggaatggttggcaagtcagctgactttgtt
gttgaggctattggcacagaagtaggaactctagggttttctattgagggcccctctcaa
gcaaagatagagtgtgatgataagggtgacggttcctgtgatgtgcgctactggcccact
gaacccggagattatgcagttcatgttatctgtgatgatgaagatatcaaagacagcccc
ttcatggcccatatccttccagcagccaatgacgtctttcccgagaaggtcaaagcattt
gggccaggcctggagcccactggagttactgtcaacaagtcaacacaattcactgtcgat
gccagagaagcgggcaagggaggtctgaagatctatgctcaggatgctgaaggctgtgtg
attgacatccagattactgataaaggagatggcacttttgtttgtgtgtatgttccaacc
aagccagtgaagcacaccattataattacctggggggaggtcaacatacctaaaagtcct
tttagagttcttgttggtgaaggctgccaccctgacaaagtcaaggtctatggacctgga
gttgagaaaaccggcctgaaggcaaatgagcccacttactttactgtcgactgtagtgaa
gctggccaaggagatgtcagcattgggatcaaatgtgcccctggtgtggtgggtccagca
gaggcggatatagattttgacatcataaaaaatgacaatgacacctttactgtcaagtat
acacctcctggccctggccgttacaccatcatggttgtctttgcagatcaggaaatcccc
agcagcccattcaaagtcaaggtggacccatctcatgatgctggtaaagtcagagctgaa
ggtcctggaattaacaagacaggcgttcaggtggaaattccaacccatttcaccatcttc
accaaaggagcaggaaaggcaaaaccagaggtgcatttcaaaacagctgccaaaggaaat
gctgtaaaggattttgagatcattgataaccatgactactcctacactgtgaagtacaca
gctcttcatcagggtgagatggctattgtggtcacacacggtggggatcccattcccaaa
agtcctttcaagatcacagtcgccccttcacttgatcttggcaaagtcaaagttcaaggt
cttaatgaaaaagtggaagttggaaaggaccaggagtttattgtgaacacaaaaggggct
ggtggacagggtaaggtaaatgtgagcataacctcaccctctggcagaccaataccatgt
aagctggaatcagacaagacaaaggaggccacctgtgtgaagtacatcccacctgaggag
ggccattacaaggtagacatcacctatgatgggaaccctgttccagaaagtcccttttct
gtggagggactcatgcctgctgatccttccaaggttcgggcctatggaccaggactgaag
ggtggtattgtgggccagccagcaaagttctctatagacacgaaaggagcaggtgctggt
ggtctgggtctaacattggaaggtccatgtgaggctaagattgaatgccaagacaatggt
gatggaacctgctcagttgtctacctgcccacagaagctggggactacaacatcaatatt
ctttatggggaggctcatatccctggctctccttttaaagcagttgtcaagccagctctg
gatgctggcaaggttacagcgagtggcccaggactggaaagggccaaagctggcgaggtg
gccagtttcacagtagactgcagtagagccggagaggctgaactcaccattgagattgtg
tcagattcaggggctcaagctgaagtttgcattcaaaacaacaaagatgggacattttct
gtcacctacaccccactctttcatggggtacacactattaccattaaatatggaggtcag
caggtgcccaagagtcccatacatgtgaaagtggagccatctgtggacactagtggaatt
aaagtctatggaccaggagttgagcccaaaggggtcctcagggaggtgacaacacacttc
attgtggatgcacgggcccatgccaagaccaaaggaggcaatcatgttaagattcgtatc
atcaatccatcaggcgcaaacacggatgcatatatcactgataagggtgatggcacatat
agagtggaatatacagctttcgaggatggtttgcacctgattgaggtcttttatgatgaa
gttgctgttcctaaaagtccctttaaggtgtcagttgttgaaggttgtgacccaacacgt
gtccgggcttatggtccaggcctggaaggtgggatagtcaacaaacccaactgcttcaca
gtagagacaaggggtgctgggacagctggtttgggcttaaccatcgaaggtgcatcagag
gctaaaatgctctgcaaagacaacaaagacggtagctgcagtgttgaatatatgcctttc
actgctggagactatgatatcaatattgcttacggaggccagcctattccaggcagtcca
tttcgggtgcaagttaaggatgtggtggatgtcagtaaggtgaagtgttctggtcctgga
cttgcaaacaaagttactgcacatgttccacaaaccttcactgtggactgcagcaaagct
ggagtggctcctctagaggtacagctgtatggaccaaaaggaactctggagcctgttgtt
gttaaaaacaatagggatggaacacacactgtcaactatacccctgcgcaggaggggccg
cacactgtgtctgttaaatatgccaaccaagaagtacctagcagcccttacaaagttaat
tcagctccctcgcatgatgccagtaaggtacgtgctagtggacctggcttggacactaca
ggagtggctgccagtctaccagtggagtttaccattgacgctcgtgatgcagggaaaggc
cttctgacagttcaaattctagatccagaaggaaagccgaaaaaagccagcattcatgac
aacagagatggaacctacaccgtgtcttatgtgccagacatgactggccgctacaccata
actattaaatatggcggcgataacattccatattcaccttacaatgtccaagcctttcct
actggtgatgccagcaagtgtctgctcacagtgtctattggcggacatggtgttgcagaa
agccttgggcccaatatccagatgtcggaagagacagtcatcactgtggatgcaaaggct
gctggaaaaggaaaggtaacatgcacagttcagaccccgaatggcatggagctggatatg
gatgttacagaaaatcccgatggcaccttcgacatatattacacagcacccgagccggga
aaatatgtcatcacaatccgctttggaggtcaacacattccaaaaagtccttttcaagtc
atggctacagatcaacctgttgcaccgagagatgacaccaaacccatgttccagcctcta
aatttagttatcccatttactgtccagcaaggagagctcagtggagaagtacgtatgcca
tctggaaagacagctcgtccgttcatcagggacaacaaagatgggacagtcacagtgcag
tttcagcctacagagaaaggcctgcatgaaatggacataaagtacgatggcaaccacatc
ccaggaagccctctgcagttctacgttgacgtaacaaacagtggaatggtgacagcctat
ggaccaggtctgtgtcacggaacagtcaataaaccagcttctttcactgttgtcactaag
aatgctggacaaggtggtttgtcccttgctgttgagggtccatctaaagctgaaatcagc
tgtaaggacaataaagacggcacctgcactgtgtcatacttgccgacaacaccgggtgat
tacaacatcattgtcaagtttgacaacagccatatccctggcagccccttcacagcaaag
atcaccggtgacgattcgctccgacgttctcaactgaatgttggcacagcagcagacgtc
tcgctaaagatcacagaaacagacctgagctatctaacagctagcatcaaagctccatca
ggaaaggaggaaccttgtctactgaagagattgcccaaccggcacattggtctctccttt
accccaaaagaagttggggagcatgaggtcagtgttaggaagagtgggaaacatgtaaac
aacagccctttcaagattatggttggaccatcggaaatcggagaagccagcagggtcaag
gcttttggtaaaggactagttgaagcacacacctttgaagtggccgagttttttgtggac
actagaaatgctggatatggaggacttggattgtcaatcgaaggtccaagtaaagtggat
atcaactgtgacgatgttgaagatggaacatgcaaagtgacatattgcccaaccgaacca
ggcaactacatcatcaatatcaaatttgcagacaaacacataccaggaagtccatttaca
gtgaaggtaacaggagaaggaagaatgaaacagagtataacaaggaaaaggcaagctgcc
tctattgcatcagtaggcagcacatgcgacctaaacctaaaaattccaggaaattggttt
caaatgctgtcagcacaggagcgcttaactcgtaccttcacccgcagcagccacacttac
acacgtacagagcgcacagaaatcagcaagacacatggaggtgagactaagcgggaggta
catgtagaggagagcacacaggttggcgggggcggtggtgaccctttcagagatgtattt
gaatccttcctgggaagagaccgactgggtagctttggtacaatccggcaagaaggagaa
acagggatccagggaatgacggcgcaggttaccagccctggtggaaatctggcagatgca
gagatcgttgatagtggaaacagtacctacagagtccgctttgtgcctactgaaatgggt
tctcacaccgtcaacgtcaaatacaggggcgagcatgtacctggaagccccttccagttt
acagttggcccacttggggaaggaggtttccacaaggtccgggctggaggcacaggccta
gagagagctgtcgcaaaagttcccgctgaattcagtatttggacaagagaggctggagcg
ggtggtctgtccattgctgtagaagggccaagcaaggctgaaatcaactttgaggacaga
aaagatggatcttgtggtgtcagctatgttgtgcaggagcctggtgactatgaagtttct
atcaagttcaataatgagcatatcccagatagtccctttattgttcctgttgccacacta
tcagatgacgcacgacgacttactgttacaagccttcaggagaaggatttgaaggttaat
caggaggcctcattcgcagttcagaggaatggagctaggggtgtcatagatgcaaaagtt
cacgctccatctggtgtggtagaggagtgttatgtcaccgaattggatagtgacaaaaat
gcaattcgcttcattccacgtgagaatggtgttcactctattgacgtgaagttcaatgga
agccacatcccaggcagcccattcaaagtccgtgttggagaagcagaaagtgttggagat
ccaggaatggtgtctgcttttggtccaggacttgagggtggacgcacaggagtcccatct
gagtttgtcgtcaacacatgcaaggctggttctggtgctttatctgttactattgacggt
ccctcaaaagtcaaaatggattgcaatgagtgccaggaaggttacaaaatctcttacaca
ccaatggcaccaggcaactatctcatttgcatcaaatatggtgggccgcagcatattgtt
ggcagccccttcaaagcaaaggtcataggtatgcgtctttctggggggcacagtttgcac
gaaacttcatcagtcattgtggaaacagttaccaagtcctccaagatggccggagcatac
agctctctgaccagctctatgccaacatcagacgccagtaaggtcgtgtgtcacggtgct
ggcctttccaaagccttcgtgggtcagaagaacagtttttctgtagactgcagtaaagca
ggtacaaacatgctcatggttggtgtccacggtcctagaactccatgtgaagatgtgaca
gtcaagcatatgggaaacaagctttacaacgtgacctacaccgtgaaggagaaaggaaac
tatgtagtgattgttaaatggggggacgaaactataccagggagtcctttccatgtaagc
gctccttaa

DBGET integrated database retrieval system