KEGG   Danio rerio (zebrafish): 100124594Help
Entry
100124594         CDS       T01004                                 

Gene name
aspg, zgc:171644
Definition
asparaginase homolog (S. cerevisiae)
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
17
AA seq 626 aa AA seqDB search
MTSLCRALSRSKLNQSDTFQSQKSLSRSAAGQSRRRFSSSSESPPDVSPNVEARVLVINT
GGTIGMTYHNNVLSPEPNAFVETLRKLPILHDEQYAQHTRLYDYYKPQENTLVLPLSKQN
KRIVYTVLEYSPLLDSCNMTTDDWATIGKDIEKHYEQYDGFVILHGTDTMAYTASALSFM
CENLGKPVILTGSQVPIYEMRNDGRDNLLGALLIAGQFVIPEVCLYFHHKLYRGNRVTKV
DAGSFNAFNSPNLPPLANAEVDIKINWDTVWRANTTAKFTVNTQMNRNVGLLRLFPGITA
DTVRAFLQPPMDGIVLETYGSGNAPDNRADLLGEIRKATQRGLIMINCTQCLRGSVTTSY
ATGQALSDAGLVAGCDMTPEAALSKLSYVLAKQNLSIEEKKKMLSRNLRGEMIADVGGAK
LSLSDSRFIQVIAKSLSISCKEELEAIRDALTPTLVCVAAKIGDVDALEAIREMGTDLSM
ADYDGRTPLHIAACEGHLKVVEYLLGKGATVYAKDRFGHTPLRNAVRFRHKDVVKLLRKT
GAHFSREEMADAGTELCSLAAAGDLEGLEIWQLAGVDLTMTSYDGQTPIEVARATGCVES
VEFLKQAALYQTQNGEYIEFTAAPRS
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgctgtgtcgagctctttcccgcagcaagttaaatcagtcggatacgtttcag
tcgcagaagtctctgtcccggagcgccgcgggtcagagtcgccggaggttctccagcagc
tccgagtctcctcctgatgtgagccccaatgtcgaggcgagggtcctggttatcaacacc
ggcgggaccatcgggatgacgtatcacaataacgttttgtctccagagcctaatgctttt
gttgaaacgctgcgcaaactgcccattctgcatgacgagcaatacgcacaacatacgaga
ctgtacgactactacaagcctcaggagaacacgctggtgctgccattgtccaaacagaat
aagaggattgtatacacagttttagagtactcgcctcttcttgactcctgcaatatgacc
acagatgactgggccactattggaaaagacatcgagaaacactatgagcaatatgatggt
ttcgtcatcctgcatggtacagacactatggcttacaccgcatctgccttatccttcatg
tgtgagaacctggggaagccagtcatcctcactggatcacaggtgcccatctatgagatg
aggaacgatgggagagacaacttgttgggggcgctgttaatagcggggcagtttgtcatc
cccgaggtttgtctctattttcatcataagctctacaggggcaatcgggtcacaaaagtg
gatgctggaagctttaacgcatttaactccccaaacctgccaccattggccaatgctgaa
gtcgacattaaaattaactgggacactgtgtggcgagccaatacaaccgctaaattcact
gtcaacacccagatgaaccgtaacgtgggtctcctgcggctcttcccaggaatcactgct
gatacagtcagggcctttttgcagcctcctatggacgggatagtattggagacgtatggc
agtggtaacgcccctgataaccgcgctgacctgctgggtgagatccgtaaggcgactcag
agaggactcatcatgattaactgcacccagtgtctcaggggctcggtcacgacctcgtac
gccacgggacaggctctgagtgatgccggtttggtcgctgggtgtgatatgaccccagaa
gctgctctttcaaaactgtcctatgtgctggcaaaacagaatctcagtatagaagagaaa
aagaagatgctgagtcgcaacctgcgtggtgaaatgattgctgacgtaggtggagcaaag
ctttctctcagcgacagtcgctttattcaggtcatcgccaagtccctcagcatcagctgt
aaagaggagcttgaagccattcgagatgcactaacacccactctagtctgtgttgcggcc
aagatcggagatgttgatgctttagaggccatcagggaaatgggcactgacttgagcatg
gcggattacgacgggcgtactcctctccacatcgccgcatgcgaaggccatctgaaggtg
gtggagtatctgctgggtaaaggagccactgtctatgctaaagatcgctttggccataca
cctctgcgcaatgctgttcgcttcaggcataaagatgttgtgaagctgctgaggaagact
ggagctcatttttccagggaggaaatggcggatgctggaacagagctgtgcagtcttgca
gccgctggtgatttggaaggattggagatttggcagttggctggggttgatttgaccatg
accagttatgatgggcaaacacccattgaagtggcaagagccactggatgtgtggagtct
gttgagttcttaaaacaggcggctctgtaccaaactcagaatggcgagtacatcgaattt
actgccgctccaagatcttga

DBGET integrated database retrieval system