KEGG   Danio rerio (zebrafish): 100125912Help
Entry
100125912         CDS       T01004                                 

Gene name
prkg2, si:dkey-18e17.2
Definition
protein kinase, cGMP-dependent, type II (EC:2.7.11.1)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dre  Danio rerio (zebrafish)
Pathway
Gap junction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell communication
   04540 Gap junction
    100125912 (prkg2)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100125912 (prkg2)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100125912 (prkg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 768 aa AA seqDB search
MGNGSMKLNPLKQVSGSAKSKNNGESSLVPQVLRVRVEELETHLKKKDEDLNAKELQIKH
LEEQLAQQKQTLSEISDTLRSKCLQLNKLQDALKSQGELGLLPSPLKEKVSQGLTGLLRE
TLNRRKGAKAGVSAEPSSRTYDSSGIPKFYFESARVWKEQSVKKLLTDALNKNQYLRRLE
VQQVKDMVECMYERTYQQGEYVIKQGEPGNHLFVLADGKLDVYQHNKLLTSIAVWTTFGE
LAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGD
KLTKIVDCLEEYYNKGDYIIREGEEGNTFYIIANGKIKVTQSTQDHEEPQIINTLGKGDY
FGEKALISDDVRSANIIAEEDGVECLVIDRETFSQTVGTFDELKKYLQSYVDSLARDDKK
RNAKRSGSCTPPNTPVSHDMIELKERESSFASTIPFTCLEAIATLGVGGFGRVELVKLKN
ENVTFALKCIKKRHIVDNRQEEHIYSERRILLETNCPFIVKMYRTYKDNKYVYMLLEACL
GGEIWSLLRDRGSFEEYTAKFCVGCVTEAFDYLHNNGIIYRDLKPENLMLDTDGYVKLVD
FGFAKKLKCGQRTWTFCGTPEYVAPEIILNKGHGLSVDFWSLGILIFELLTGSPPFTGSD
QMIIYTFILKGIEKMDFPKKITKRPGDLIRKLCRQNPSERLGNLKNGITDIKKHRWFTGF
SWSGLKARNLISPLKREVKGPTDHSYFDSYPPEEEIPPDEMSGWDTDF
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggctcgatgaagctgaaccctctaaagcaggtcagtggatcggccaaatcc
aaaaacaatggagaatcaagcttggtccctcaagtcctcagagtacgtgtggaagaatta
gagactcatctgaagaagaaggatgaagacctgaatgccaaagagcttcagatcaagcat
ctggaggagcagctggcccagcagaagcagaccctctctgagatctctgacacgttaagg
agcaagtgtctccagctcaacaagcttcaggacgctctgaagagtcaaggggagctgggc
ctcctgccctcacccctcaaggagaaagtcagtcaaggtctcacaggcctgctcagagaa
acactcaacaggagaaaaggagcaaaagctggagtatcagcagagccttcatccagaacg
tatgattccagtgggattccaaagttctacttcgagagcgcacgagtctggaaagagcag
agtgtaaagaagctcctgacagatgctctgaataagaaccagtatctgaggagactggaa
gtgcagcaggtcaaagacatggtcgaatgtatgtatgaacggacctaccagcagggagag
tatgtcatcaaacaaggagagcctggaaaccacttgtttgtgcttgcagatggcaagctg
gacgtctatcagcacaacaaactgctcacatcaatagcagtctggaccacgtttggtgaa
ctggccatcttgtacaattgcaccaggactgcatcagtcaaagcggccagcaatgtgaag
acatgggctctggatcgagaagtcttccacaacatcatgcgcatgactgccgaggctcga
cacgagcaataccgcaacttcctgagaagtgtttcacttcttgccagtcttcctggggac
aagctaacaaagattgtggactgcttagaggagtattataataaaggagattacatcatc
cgggagggagaggaaggaaacaccttttatataattgccaatggaaagattaaagtcaca
cagagcacacaggatcatgaagagcctcagatcatcaacaccttggggaagggggattat
ttcggagagaaggccctcatcagtgatgatgtgagatctgcaaatataatcgcagaagag
gatggtgtggagtgccttgtgatcgatcgagaaactttcagtcagactgttggaactttt
gacgagcttaagaagtatcttcagagctatgtcgatagtttggcacgagatgataagaaa
agaaatgctaagaggtcaggaagctgcactccacccaacacaccagtgtcacatgacatg
atcgagctaaaggagagagagagcagctttgcatccactatacccttcacctgccttgag
gctattgccactctgggagtcggaggctttggcagagttgaactggtgaaactgaagaat
gaaaatgtgacatttgctctaaaatgcatcaagaaacggcacattgtggataacagacaa
gaagagcacatttactctgagaggaggatcttgctggagacaaactgtcctttcattgtg
aaaatgtatcgcacatacaaagacaacaagtatgtgtacatgctgctggaggcctgtctg
ggtggagagatttggagtcttctgagggacagggggagttttgaagagtacactgcaaag
ttctgcgtgggctgtgtaacagaggcttttgactatctgcataataatggcatcatatac
agagacctaaagcctgagaatctgatgctggacacagatggatacgtcaagttggtggat
tttggctttgccaagaagctgaagtgtggccagaggacatggacattctgtgggactcca
gagtatgtggcgcctgagatcatcctcaataaaggccacgggcttagtgtcgacttctgg
tctttaggaatcctgatatttgaacttcttactggaagcccgccttttactggctcagat
cagatgattatatatacattcattctgaaaggaattgagaagatggacttcccgaaaaag
atcaccaagaggccaggtgaccttattcgaaagctgtgcagacaaaacccttcagagcga
ctgggcaacctgaagaatggaataactgatattaaaaagcacagatggtttacaggtttt
agctggagtggtctgaaagcccgaaatctgatatcaccacttaaaagagaggtgaaggga
cccactgaccacagttactttgatagttatcctcctgaagaagaaatccctccagatgaa
atgtcaggctgggacacagacttctaa

DBGET integrated database retrieval system