KEGG   Danio rerio (zebrafish): 100125912Help
Entry
100125912         CDS       T01004                                 

Gene name
prkg2, si:dkey-18e17.2
Definition
protein kinase, cGMP-dependent, type II (EC:2.7.11.1)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dre  Danio rerio (zebrafish)
Pathway
Gap junction
Class
Cellular Processes; Cell communication; Gap junction [PATH:dre04540]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 768 aa AA seqDB search
MGNGSMKLNPLKQVSGSAKSKNNGESSLVPQVLRVRVEELETHLKKKDEDLNAKELQIKH
LEEQLAQQKQTLSEISDTLRSKCLQLNKLQDALKSQGELGLLPSPLKEKVSQGLTGLLRE
TLNRRKGAKAGVSAEPSSRTYDSSGIPKFYFESARVWKEQSVKKLLTDALNKNQYLRRLE
VQQVKDMVECMYERTYQQGEYVIKQGEPGNHLFVLADGKLDVYQHNKLLTSIAVWTTFGE
LAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGD
KLTKIVDCLEEYYNKGDYIIREGEEGNTFYIIANGKIKVTQSTQDHEEPQIINTLGKGDY
FGEKALISDDVRSANIIAEEDGVECLVIDRETFSQTVGTFDELKKYLQSYVDSLARDDKK
RNAKRSGSCTPPNTPVSHDMIELKERESSFASTIPFTCLEAIATLGVGGFGRVELVKLKN
ENVTFALKCIKKRHIVDNRQEEHIYSERRILLETNCPFIVKMYRTYKDNKYVYMLLEACL
GGEIWSLLRDRGSFEEYTAKFCVGCVTEAFDYLHNNGIIYRDLKPENLMLDTDGYVKLVD
FGFAKKLKCGQRTWTFCGTPEYVAPEIILNKGHGLSVDFWSLGILIFELLTGSPPFTGSD
QMIIYTFILKGIEKMDFPKKITKRPGDLIRKLCRQNPSERLGNLKNGITDIKKHRWFTGF
SWSGLKARNLISPLKREVKGPTDHSYFDSYPPEEEIPPDEMSGWDTDF
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggctcgatgaagctgaaccctctaaagcaggtcagtggatcggccaaatcc
aaaaacaatggagaatcaagcttggtccctcaagtcctcagagtacgtgtggaagaatta
gagactcatctgaagaagaaggatgaagacctgaatgccaaagagcttcagatcaagcat
ctggaggagcagctggcccagcagaagcagaccctctctgagatctctgacacgttaagg
agcaagtgtctccagctcaacaagcttcaggacgctctgaagagtcaaggggagctgggc
ctcctgccctcacccctcaaggagaaagtcagtcaaggtctcacaggcctgctcagagaa
acactcaacaggagaaaaggagcaaaagctggagtatcagcagagccttcatccagaacg
tatgattccagtgggattccaaagttctacttcgagagcgcacgagtctggaaagagcag
agtgtaaagaagctcctgacagatgctctgaataagaaccagtatctgaggagactggaa
gtgcagcaggtcaaagacatggtcgaatgtatgtatgaacggacctaccagcagggagag
tatgtcatcaaacaaggagagcctggaaaccacttgtttgtgcttgcagatggcaagctg
gacgtctatcagcacaacaaactgctcacatcaatagcagtctggaccacgtttggtgaa
ctggccatcttgtacaattgcaccaggactgcatcagtcaaagcggccagcaatgtgaag
acatgggctctggatcgagaagtcttccacaacatcatgcgcatgactgccgaggctcga
cacgagcaataccgcaacttcctgagaagtgtttcacttcttgccagtcttcctggggac
aagctaacaaagattgtggactgcttagaggagtattataataaaggagattacatcatc
cgggagggagaggaaggaaacaccttttatataattgccaatggaaagattaaagtcaca
cagagcacacaggatcatgaagagcctcagatcatcaacaccttggggaagggggattat
ttcggagagaaggccctcatcagtgatgatgtgagatctgcaaatataatcgcagaagag
gatggtgtggagtgccttgtgatcgatcgagaaactttcagtcagactgttggaactttt
gacgagcttaagaagtatcttcagagctatgtcgatagtttggcacgagatgataagaaa
agaaatgctaagaggtcaggaagctgcactccacccaacacaccagtgtcacatgacatg
atcgagctaaaggagagagagagcagctttgcatccactatacccttcacctgccttgag
gctattgccactctgggagtcggaggctttggcagagttgaactggtgaaactgaagaat
gaaaatgtgacatttgctctaaaatgcatcaagaaacggcacattgtggataacagacaa
gaagagcacatttactctgagaggaggatcttgctggagacaaactgtcctttcattgtg
aaaatgtatcgcacatacaaagacaacaagtatgtgtacatgctgctggaggcctgtctg
ggtggagagatttggagtcttctgagggacagggggagttttgaagagtacactgcaaag
ttctgcgtgggctgtgtaacagaggcttttgactatctgcataataatggcatcatatac
agagacctaaagcctgagaatctgatgctggacacagatggatacgtcaagttggtggat
tttggctttgccaagaagctgaagtgtggccagaggacatggacattctgtgggactcca
gagtatgtggcgcctgagatcatcctcaataaaggccacgggcttagtgtcgacttctgg
tctttaggaatcctgatatttgaacttcttactggaagcccgccttttactggctcagat
cagatgattatatatacattcattctgaaaggaattgagaagatggacttcccgaaaaag
atcaccaagaggccaggtgaccttattcgaaagctgtgcagacaaaacccttcagagcga
ctgggcaacctgaagaatggaataactgatattaaaaagcacagatggtttacaggtttt
agctggagtggtctgaaagcccgaaatctgatatcaccacttaaaagagaggtgaaggga
cccactgaccacagttactttgatagttatcctcctgaagaagaaatccctccagatgaa
atgtcaggctgggacacagacttctaa

DBGET integrated database retrieval system