KEGG   Danio rerio (zebrafish): 100125912Help
Entry
100125912         CDS       T01004                                 

Gene name
prkg2
Definition
(RefSeq) cGMP-dependent protein kinase 2
  KO
K19477  cGMP-dependent protein kinase 2 [EC:2.7.11.12]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04540  Gap junction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100125912 (prkg2)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100125912 (prkg2)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  PKG family
   100125912 (prkg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase cNMP_binding Pkinase_Tyr Kinase-like SPATA24 Fmp27_WPPW CC2-LZ DUF4600 MPS2 APH Seadorna_VP7 DUF3552 ATG16
Motif
Other DBs
NCBI-GeneID: 100125912
NCBI-ProteinID: NP_001098749
ZFIN: ZDB-GENE-060531-80
Ensembl: ENSDARG00000054741
Vega: OTTDARG00000018026
UniProt: A2AVJ3
Position
5
AA seq 768 aa AA seqDB search
MGNGSMKLNPLKQVSGSAKSKNNGESSLVPQVLRVRVEELETHLKKKDEDLNAKELQIKH
LEEQLAQQKQTLSEISDTLRSKCLQLNKLQDALKSQGELGLLPSPLKEKVSQGLTGLLRE
TLNRRKGAKAGVSAEPSSRTYDSSGIPKFYFESARVWKEQSVKKLLTDALNKNQYLRRLE
VQQVKDMVECMYERTYQQGEYVIKQGEPGNHLFVLADGKLDVYQHNKLLTSIAVWTTFGE
LAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGD
KLTKIVDCLEEYYNKGDYIIREGEEGNTFYIIANGKIKVTQSTQDHEEPQIINTLGKGDY
FGEKALISDDVRSANIIAEEDGVECLVIDRETFSQTVGTFDELKKYLQSYVDSLARDDKK
RNAKRSGSCTPPNTPVSHDMIELKERESSFASTIPFTCLEAIATLGVGGFGRVELVKLKN
ENVTFALKCIKKRHIVDNRQEEHIYSERRILLETNCPFIVKMYRTYKDNKYVYMLLEACL
GGEIWSLLRDRGSFEEYTAKFCVGCVTEAFDYLHNNGIIYRDLKPENLMLDTDGYVKLVD
FGFAKKLKCGQRTWTFCGTPEYVAPEIILNKGHGLSVDFWSLGILIFELLTGSPPFTGSD
QMIIYTFILKGIEKMDFPKKITKRPGDLIRKLCRQNPSERLGNLKNGITDIKKHRWFTGF
SWSGLKARNLISPLKREVKGPTDHSYFDSYPPEEEIPPDEMSGWDTDF
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggctcgatgaagctgaaccctctaaagcaggtcagtggatcggccaaatcc
aaaaacaatggagaatcaagcttggtccctcaagtcctcagagtacgtgtggaagaatta
gagactcatctgaagaagaaggatgaagacctgaatgccaaagagcttcagatcaagcat
ctggaggagcagctggcccagcagaagcagaccctctctgagatctctgacacgttaagg
agcaagtgtctccagctcaacaagcttcaggacgctctgaagagtcaaggggagctgggc
ctcctgccctcacccctcaaggagaaagtcagtcaaggtctcacaggcctgctcagagaa
acactcaacaggagaaaaggagcaaaagctggagtatcagcagagccttcatccagaacg
tatgattccagtgggattccaaagttctacttcgagagcgcacgagtctggaaagagcag
agtgtaaagaagctcctgacagatgctctgaataagaaccagtatctgaggagactggaa
gtgcagcaggtcaaagacatggtcgaatgtatgtatgaacggacctaccagcagggagag
tatgtcatcaaacaaggagagcctggaaaccacttgtttgtgcttgcagatggcaagctg
gacgtctatcagcacaacaaactgctcacatcaatagcagtctggaccacgtttggtgaa
ctggccatcttgtacaattgcaccaggactgcatcagtcaaagcggccagcaatgtgaag
acatgggctctggatcgagaagtcttccacaacatcatgcgcatgactgccgaggctcga
cacgagcaataccgcaacttcctgagaagtgtttcacttcttgccagtcttcctggggac
aagctaacaaagattgtggactgcttagaggagtattataataaaggagattacatcatc
cgggagggagaggaaggaaacaccttttatataattgccaatggaaagattaaagtcaca
cagagcacacaggatcatgaagagcctcagatcatcaacaccttggggaagggggattat
ttcggagagaaggccctcatcagtgatgatgtgagatctgcaaatataatcgcagaagag
gatggtgtggagtgccttgtgatcgatcgagaaactttcagtcagactgttggaactttt
gacgagcttaagaagtatcttcagagctatgtcgatagtttggcacgagatgataagaaa
agaaatgctaagaggtcaggaagctgcactccacccaacacaccagtgtcacatgacatg
atcgagctaaaggagagagagagcagctttgcatccactatacccttcacctgccttgag
gctattgccactctgggagtcggaggctttggcagagttgaactggtgaaactgaagaat
gaaaatgtgacatttgctctaaaatgcatcaagaaacggcacattgtggataacagacaa
gaagagcacatttactctgagaggaggatcttgctggagacaaactgtcctttcattgtg
aaaatgtatcgcacatacaaagacaacaagtatgtgtacatgctgctggaggcctgtctg
ggtggagagatttggagtcttctgagggacagggggagttttgaagagtacactgcaaag
ttctgcgtgggctgtgtaacagaggcttttgactatctgcataataatggcatcatatac
agagacctaaagcctgagaatctgatgctggacacagatggatacgtcaagttggtggat
tttggctttgccaagaagctgaagtgtggccagaggacatggacattctgtgggactcca
gagtatgtggcgcctgagatcatcctcaataaaggccacgggcttagtgtcgacttctgg
tctttaggaatcctgatatttgaacttcttactggaagcccgccttttactggctcagat
cagatgattatatatacattcattctgaaaggaattgagaagatggacttcccgaaaaag
atcaccaagaggccaggtgaccttattcgaaagctgtgcagacaaaacccttcagagcga
ctgggcaacctgaagaatggaataactgatattaaaaagcacagatggtttacaggtttt
agctggagtggtctgaaagcccgaaatctgatatcaccacttaaaagagaggtgaaggga
cccactgaccacagttactttgatagttatcctcctgaagaagaaatccctccagatgaa
atgtcaggctgggacacagacttctaa

DBGET integrated database retrieval system