KEGG   Danio rerio (zebrafish): 100126106Help
Entry
100126106         CDS       T01004                                 

Gene name
ano9a, im:7157234, zgc:171937
Definition
anoctamin 9a
Orthology
K11252  
histone H2B
Organism
dre  Danio rerio (zebrafish)
Brite
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100126106 (ano9a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
25
AA seq 124 aa AA seqDB search
MPEPAKTAPKEGSKKAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccagcaaagactgcacccaaggagggctccaagaaagccgtcaccaagacc
gccggtaaaggtggaaagaagcgcaagaggaccaggaaggagagctatgctatctacgtc
tacaaggtgttgaagcaggtccatcccgacaccgggatctcctccaaggcgatgggcatc
atgaactccttcgtcaacgacatcttcgagcgcatcgccggtgaggcgtctcgtctcgct
cactacaacaagcgctccaccatcacttccagagagatccagaccgctgtgcgtctgctg
ctgcccggagagctggccaaacacgccgtgtctgagggcacgaaggccgtcaccaagtac
accagctccaagtaa

DBGET integrated database retrieval system