KEGG   Danio rerio (zebrafish): 100126133Help
Entry
100126133         CDS       T01004                                 

Gene name
ppt2, zgc:174932
Definition
palmitoyl-protein thioesterase 2 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dre  Danio rerio (zebrafish)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dre01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:dre00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dre04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
19
AA seq 287 aa AA seqDB search
MKGACVWTLVSVCVFCVCVAYKPVIVVHGLFDSSADFVHLHRFINLSHPGTNVTVLDLFD
RSASLQPLWKQVEGFTEAIYPIMQNAADGVHLICYSQGGLVCRGILSTLPDHNVHSFISL
SAPQAGQYGDTDYLKYLFPQFVKSNLFHVCYTAVGQKISICNYWNDPHHRDMYINSSDYL
ALLNNERPNPNSTAWKQNFLRIKKLVLIGGPDDGVITPWQSSQFGFYDDNETVVEMKNQK
VFLMDLFGLKTLSARGDLALCSVEGVAHIFWHSNETVYKTCIEKWLT
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtgcgtgtgtgtggacgctggtgtctgtttgtgtgttttgtgtgtgtgttgcg
tataaaccggtgatcgtcgttcacgggctcttcgatagctcagctgacttcgtccaccta
caccgattcatcaacctgtctcacccgggcactaatgtcactgtcctggacctatttgac
cgcagtgccagcctgcagcccctctggaagcaggtggagggcttcacagaagccatatat
cccatcatgcagaatgcagctgatggtgtccacttgatctgctactcacaaggtggcttg
gtatgtcgaggaattctgtccactctcccagaccataatgtacactcttttatatctctg
tctgctccacaggcaggacagtatggagacacagactatttgaagtacctgttccctcag
tttgtcaaatccaacttgtttcatgtatgctatactgcagtgggccagaaaatatcaatc
tgtaactactggaatgaccctcatcacagagacatgtacatcaacagcagtgactatctg
gccttactaaacaatgaaagaccaaatcccaactctactgcttggaaacaaaactttctg
cgtattaagaagctagtactgattggcggccctgatgatggggtaatcacaccatggcag
tcaagtcagtttggtttctatgatgataatgagactgtcgttgagatgaaaaaccagaaa
gtgtttctgatggacttgtttggactgaagacgttgtctgctcgaggggatctggctctg
tgttcagtggaaggcgttgcgcatatcttctggcactccaatgaaacggtgtataaaacc
tgcattgaaaaatggcttacatag

DBGET integrated database retrieval system