KEGG   Danio rerio (zebrafish): 100136866Help
Entry
100136866         CDS       T01004                                 

Definition
zgc:172295 (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100136866
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100136866
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     100136866
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100136866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
1
AA seq 530 aa AA seqDB search
MAASSNRIMLGPLVAAIDQGTSSTRFLVFNAKTAELLSHHQVEIKQSFPKEGWVEEDPKE
ILQSVYECMDRTCEKLTQLNIDVSNIKAVGVTNQRETTLVWDKQTGEPLYNAIVWLDLRT
QSTVERLINKTPGKNKNHLKDKTGLPISTYFSAVKLRWLMDNVEKVHEAVLSHRAMFGTV
DSWLIWCLTGGKNGGVHCTDVTNASRTMLFNIHTMDWDPELCIYFDIPMGILPKVRSSSE
IYGLMKSGPLTGVPISGCLGDQSAALVGQMCFKDGQAKNTYGTGCFLLKNVGTKPVMSDH
GLLTTVAYKLGRDKPACYALEGSVAIAGAVVRWLKDNLGIIQTSTELEKLAADVGTSYGC
YFVPAFSGLYAPYWEPSARGIICGLTQFTNRSHLAFAALEAVCFQTREILDAMNQDSGIN
LSQLQVDGGMTSNRLLMQLQADILCIPVVKPSMPETTALGAAMAAGAAEGVSVWSLNPED
LTEVTSEKFEPQINPEESELRYARWKKAVQRAMNWETIEPVNSGNGQKLA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatcgtcgaacaggatcatgctaggcccactcgtagctgctattgaccaaggc
acgagttctacacgttttctggttttcaatgcaaaaacggcagagcttctcagccaccat
caggttgaaattaaacagagcttccctaaagaaggatgggtggaggaagatccaaaagag
attcttcagtctgtgtatgagtgcatggacaggacctgtgagaaactgacccagcttaac
attgacgtttcaaatataaaagctgttggcgtaaccaatcagagggaaaccacccttgta
tgggacaaacaaacaggagaaccactttataatgctatagtttggcttgatctgcggacc
cagtccacagtagaaagactcatcaacaaaacacctggcaagaacaaaaatcacctcaag
gacaagacaggcctcccaattagcacatacttcagtgcagtgaagttgcgatggctaatg
gataatgtggaaaaggtccatgaggctgtgctttctcacagggccatgtttggaacagtt
gactcctggcttatctggtgcttgactggtgggaaaaatggaggtgttcactgcacagat
gtgaccaatgcaagtcggaccatgcttttcaatattcacacaatggactgggatccagag
ctgtgcatatattttgatataccaatgggaattttaccaaaagtgagaagttcttcagag
atttatggtttaatgaaatctggccctttaactggtgtccccatatcagggtgtcttggt
gaccaatctgctgctctggttggacagatgtgctttaaagatggacaagctaaaaatact
tatgggactggttgtttcttgcttaagaatgtaggaacaaagcctgttatgtcagaccat
ggacttctgaccacggtcgcatataaactagggcgggacaagccagcctgctatgcgcta
gagggttcagttgccattgcaggagcagttgtgcgttggctaaaggataaccttgggatt
atccagacctctacagaattggagaaactagctgctgatgttggcacatcatatggttgt
tattttgttcctgcattctctgggttatatgcaccatactgggaaccaagtgccagaggg
atcatttgtggtctaacacagttcaccaataggagtcatttggcttttgcagcccttgaa
gctgtctgcttccagactcgagagattcttgatgcaatgaaccaggacagtggaattaat
ctctctcagctccaggttgatggaggcatgacatccaaccgattactgatgcagctgcaa
gctgacatactgtgtatcccagtcgtaaagccgtccatgcctgagaccacggctctgggt
gctgccatggcagcaggagcagctgaaggggttagtgtgtggagcctgaaccctgaagat
ctcacagaggtcacttcagaaaaatttgaacctcagatcaatccagaagaaagtgaactg
cgatatgctcgttggaagaaagctgttcaaagggccatgaactgggaaaccatagagcca
gtcaacagtggaaatgggcagaagttggcttga

DBGET integrated database retrieval system