KEGG   Danio rerio (zebrafish): 100141364Help
Entry
100141364         CDS       T01004                                 

Definition
zgc:172180
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100141364
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100141364
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
11
AA seq 581 aa AA seqDB search
MILSRKPDGPVTAARHGDGLYDSYMRTDHIVNQDADVNGQSPSGLPPLPKHTGVIKPTMK
DHQAIRGGQMKVKYVYEDSYNRKLNGVSQHNGTSQVPAKPPPAISKERSVDSNSSVKSSE
SSTKVTKLGSPMTPEQALKQHRQQMTTLEQQEIHNYSEIYFLGPNAKKRQAVAGGTNNSG
YDDDQGGYIHVPHDHLAYRYEFLKVIGKGSFGQVAKVYDHKLQQHVALKIVRNEKRFHRQ
AAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSL
PLVRKFAHSILQCLEALHRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTY
IQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPP
SKLLEQAKRAKNFISSKGHPRYCTVSTLSNGTIVLNGSRSRRGKMRGAPGSKEWGTALKG
CEDATFIDFLKKCLDWDPSTRMTPVQALRHPWLYKRLPKPAPGGEKTVLPKRISEHSTSF
PTIISKVPPVMGSTNNKLRTTMMGDSTGSIPFRTVLPKLVS
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagcagaaaaccagatggccccgtaactgcagctcgccacggggatggtctg
tatgactcctacatgcgcactgatcacatagtgaaccaggacgctgatgtgaatggacag
agtccctcaggactgccccctctccccaaacacactggtgtcatcaagcctacaatgaag
gatcaccaagcaatccggggaggacagatgaaggtgaagtatgtttacgaggactcctac
aaccgcaaactcaatggtgtgagccagcacaatggcacaagccaagtaccagcaaagccc
ccacctgcaatttccaaagagagaagcgtggacagcaacagctctgtgaaatcctcagag
agctcaacaaaagtcacaaagctgggcagcccaatgaccccagaacaagctctcaagcaa
caccggcagcaaatgactaccttggagcagcaggagatccacaactattctgagatctac
ttcctgggaccaaatgccaagaaaaggcaggcagtagcaggcggcactaacaacagtgga
tatgatgatgaccaggggggatacatccacgtacctcatgaccaccttgcctatcgctat
gagttcctcaaggtgattggcaaaggtagttttggacaagtggcaaaggtttacgaccac
aagttgcagcagcatgtcgccctgaagattgtgcgcaatgagaagcgcttccatcggcaa
gctgctgaggagatccgaattctggagcacctgaagaagcaagacaagacaggcagcatg
aacgtagttcacatgttggaaaattttaccttccgcaatcacatatgcatgacttttgag
ctgctcagtatgaatctgtacgagctcatcaaacgcaacaagttccagggtttcagtctt
ccgctggtacgcaagtttgcgcactctattctccaatgcttggaagctctccatcgccat
aagatcatccactgtgacctaaaaccagagaatatcttgctgaagcagcaaggcagaagt
gggataaaagtcatcgactttggttccagctgttttgatcaccagcgtgtttacacgtac
attcaatctcggttctaccgagcacctgaagtcatcttgggatcgcgatatggtatgcct
atagacatgtggagctttggttgcattctggcagagcttcttaccggatacccattgttt
ccgggtgaggatgaaggcgaccagctggcttgcatgatggagctattgggtatgccacct
tcgaaactcctggaacaagccaagcgtgccaagaacttcatcagctccaaaggccatcca
cgctactgcacagttagcacacttagcaatggcactatagttctcaatgggagccgttct
cgcagaggaaaaatgcgaggtgcccctgggagcaaggaatggggaacggccctcaagggc
tgtgaggatgccacattcattgactttctgaagaaatgtctggattgggaccctagtact
cgtatgacaccagttcaggctttaagacatccatggctctacaagagactgcccaagcct
gcacctggtggtgagaagactgtgctacccaaacggatctcagagcacagcacctccttt
cctaccatcatctccaaggtaccccccgtcatgggctcaaccaacaacaaactgcggacc
accatgatgggggactccactggaagtataccttttcgcacagtgctgccgaagcttgtt
tcatag

DBGET integrated database retrieval system