KEGG   Danio rerio (zebrafish): 100148378Help
Entry
100148378         CDS       T01004                                 

Definition
arginase-1-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100148378
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100148378
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100148378
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 341 aa AA seqDB search
MMKMKSFSGSRAALHIFRRHLHHQRHSVGIIGAPFSKGQQKDGVQEGADLIRAAGLVQKL
KGQGCVVKDYGNVTFENLPNDESIGRLKTPRAVGRANELLSGAVQKIKSDGNTCVMLGGD
HSLAIGSISGHAASGHELSVLWVDAHADINTPLTTPTGNIHGQPMSYLIHELHSKMPKLP
NFSWLKPCVAAQDVVYIGLRDVDPEEHYILKYLGIKTFSMTEVDRLGIAKVMEQTCDHMF
SKVKKPIHLSFDIDALDPAVSPATGTPVAGGLTYREGIYITEHICQTGLLSAVDMVEVNP
KLGRTADEIKSTVNAAVDLLLGCFGRIREGSHDPDYKMPNP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagatgaagagctttagcggatcacgagcagctcttcacatattcaggagacac
ctccatcatcagcggcactctgtgggaataataggcgctccgttttccaaaggacagcag
aaggatggtgtgcaggaaggagcagacctcattcgagcggctggactggtgcagaaactt
aaagggcaaggttgtgtggtgaaggattatgggaatgtgacgtttgaaaaccttcccaac
gacgagtccatcgggagacttaagaccccgagagcggtgggacgagcaaatgagctgctt
tcaggagccgtgcagaagatcaagagtgatggaaacacatgcgtgatgctgggaggagat
cacagcctggcgatcggctcaatctctggtcatgctgcatccggacatgagctgagtgtt
ttatgggtggacgcacacgcagacatcaacacacctttaaccacaccgactggaaatatt
cacggccagccgatgtcttacctcatccacgaactgcactccaagatgcccaaacttcca
aatttctcatggctaaagccttgcgtagcagctcaggatgttgtgtatattggactccga
gatgtggacccggaagaacattatatccttaaatacctgggcatcaaaaccttctccatg
actgaagttgatcgacttggaatagcaaaagtcatggagcagacgtgtgatcacatgttt
tcaaaagtgaagaagccgatccatctgagtttcgacattgatgcgctggacccagcagtt
tcaccggcgactggcacacctgtagcaggaggactgacatatagagagggcatttacatc
actgagcacatctgccaaacagggcttctctctgctgtagacatggtggaagtgaacccc
aaactgggcagaacagcggacgagatcaaatcaacagtaaacgctgctgtggatctgctg
ctgggctgctttggacggattcgcgaaggctctcatgacccagattacaaaatgccaaat
ccataa

DBGET integrated database retrieval system