KEGG   Danio rerio (zebrafish): 100148916Help
Entry
100148916         CDS       T01004                                 

Gene name
usp46, si:ch73-16a12.1
Definition
ubiquitin specific peptidase 46 (EC:3.4.19.12)
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100148916 (usp46)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100148916 (usp46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 370 aa AA seqDB search
MTVRNIASICNMGTNASALEKDIGPEQFPINEHYFGLVNFGNTCYCNSVLQALYFCRPFR
ENVLAYKVQQKKKENLLTCLADLFHSIATQKKKVGVIPPKKFISRLRKENDLFDNYMQQD
AHEFLNYLLNTVADILQEERKQEKQNGRLKNNGTAIATDTEPEQNKIDPTWVHEIFQGTL
TNETRCLNCETVSSKDEDFLDLSVDVEQNTSITHCLRDFSNTETLCSEYKYYCEMCCSKQ
EAQKRMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSGDAVNLDRMY
DLVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSES
GYILFYQSRE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcagaaacatcgcctccatttgtaatatgggcaccaatgcctctgctctggag
aaagacatcggtccagagcagttccctattaatgaacactattttggattggtcaacttt
ggaaacacatgctattgcaactcggtgttgcaggctctgtatttctgccggccgttcagg
gagaatgtgttggcgtataaagtccagcagaagaagaaggagaatcttctcacctgtctg
gccgacctcttccacagcatcgccacgcagaagaagaaggtgggcgtgattcctcccaag
aagttcatctcacggctgcgcaaggaaaatgacctgtttgataactacatgcagcaagat
gcgcacgagttcctgaattacctgttgaacacggtggctgatatcctgcaggaggagaga
aaacaggagaagcagaacggacgactgaagaacaacggcactgccatcgccacagacaca
gagccggagcagaacaaaatcgacccaacctgggttcatgagatcttccagggcacactg
accaatgagacgcgctgtctcaactgtgagacggtcagtagcaaggatgaagacttcttg
gacttgtctgtagatgttgagcagaacacttcaataacacactgtctcagggacttcagt
aatacagagaccctgtgcagcgagtataaatactactgtgagatgtgctgtagcaaacaa
gaggcacagaaacgtatgcgtgtgaagaagttgcctatgatcttggctcttcatctgaag
cgctttaagtacatggagcagcttcatcggtacactaaactgagttatcgtgtggtcttt
ccactggagctacgcctcttcaacacctccggggacgccgtcaatctcgaccgcatgtac
gacctcgtcgctgtggtggtccactgtggcagtggcccaaacagagggcattacatcacc
atcgtgaagagccatggcttctggctgctgtttgatgacgacattgtggagaaaatagat
gcgcaggcgatagaggaattctacggtttgacctctgacatttccaagaactctgagtcg
ggatacattttgttttatcagtccagagaatga

DBGET integrated database retrieval system