KEGG   Danio rerio (zebrafish): 100148922Help
Entry
100148922         CDS       T01004                                 

Gene name
si, mgam, wu:fd42f04, wu:fd44a09
Definition
sucrase-isomaltase (alpha-glucosidase)
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
dre  Danio rerio (zebrafish)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100148922 (si)
   00500 Starch and sucrose metabolism
    100148922 (si)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100148922 (si)
    3.2.1.20  alpha-glucosidase
     100148922 (si)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Position
18
AA seq 1297 aa AA seqDB search
MNEISNFIKGSNKGCADNKLNYPPFTPRILDDLMYSKTLCMDAKQKWGNHYDVHSLYGYS
MVLATERASKEVFGTNRSMVFTRSSFPGVGKYSGHWLGDNGANWNDIKWAIPGMLEFNLF
GIPYIGADICGFFDNSTEELCRRWMQVGAFYPFSRNHNAQGYEDQDPASYGLDSLLVNTS
RHYLNIRYKLLPYLYTLFYKAHVNGETVVRPLMHEFYSDSQTWDIHKQFMWGAHLLITPV
LDPGVHYVEAYIPDAIWYDFENEIKITERKEGVKMYLPDDKLGLHLRGGAILPVQRPDVT
TTYSRRHPMGLIIALDDNKSASGELFWDDGDSRDTVSSGNHIHYQFSVTDGSLTMHVTKN
GYSDPNNLKFENITILGFSSAPPFVLVSDGTTSNPLPQSQIQYDSVKQVLNLRNLELELG
KSYTISWEAKAERIDCYPEEGATKAECEGRGCIWEPLAVPMCYYSENHGYKASNVVENMY
GITADLEINTAFPSQRSQSPDINKLRVEITFHDEICLRWKIYDPEKARYEVPVPLNLPNP
PPLWGEQTYKVEINEEPFGIRVIRKDTSEVIFDSVLPGFIFSDQFIQISTRLPTEYVYGF
GETEHPSYKHDLNFHTYGLFAKDQPPGYKLNSYGIHPFYMGMEKSKKAHGILLLNSNAMV
SEQTTQSLTGSKTGAGFLIGRPVLPAYWSLGFQLCRYGYANDSEIADLYRDMRAAEIPYD
VQYADIDYMERQMDFTLDKTNFLGLPALVDRMRGEGMRFIFILDPAIAANETTGSYAAFD
SGIEKDVFIKWPPALSNDIVWGKVWPDYPNITVDNSLDWDTQVELFRSFVAFPDFFKNGT
AEWWADQIKDYYDNVMKFDGLWIDMNEPASFVHGTVGGKCLGDPLLENPPYMPPLESKEK
GLNHKTLCMNSEQILADGTRVRHYDVHNLYGLSHTKPTYDALHSTTGKRGVIITRSTYPT
SGRWAGHWLGDNYSAWDQLLKSIIGMMEFSIFGVSYTGADICGFFNPAQKEMCLRWMQLG
AFYPFSRNHNTINMPRQDPVAWGPEFANMSRDVLNIRYTLLPYLYTLMYEAHTKGTTVVR
PMLHEFVNDEKTWDIDRQFLWGSALLITPALEEGVTVVKGYLPKTRWYDYHTNEVVEGQG
QFVDMDTPLDKINLHVRGRYIIPYQNPERNTQLSRKNPMNLLVALDGSGYATGNLFWDDG
EGIDTLKNRKYIYKQFSASRGSLSGVRETGLEEADRPLLGEVKVLGVSSSVTEVTITVTG
GSTTPLTFDYYPETQVLIIHVTPQKFKIDEYFNIVWK
NT seq 3894 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagatctccaactttataaagggaagtaacaaaggctgcgctgacaacaaactc
aactatccaccgttcaccccacgtatccttgatgacctgatgtacagtaagaccttgtgt
atggatgctaaacagaaatgggggaaccactatgatgtccacagtctttatggctactca
atggttctggccactgagagggcatcgaaagaagtgtttgggaccaaccgatccatggtc
ttcacccgctcttcattccccggtgtgggcaaatattctgggcattggttgggagacaac
ggcgccaactggaatgacattaagtgggcgatacctggcatgctggagtttaacctcttt
ggcatcccttacattggtgcagatatctgtggtttcttcgataactcgacggaggagctt
tgcagacgttggatgcaagttggtgcattttaccccttcagccgaaaccacaacgcacaa
ggatacgaagaccaggatcctgcgtcgtacggcctggactctctgctggtgaacacctcc
aggcattacctgaacatccgctacaagctgctgccatacctgtacacactgttctacaag
gcccatgttaacggagagactgtagtgcgtcccctgatgcatgagttctattctgacagt
caaacatgggatatacacaagcagttcatgtggggagcacatctcctcatcacacctgta
ctggatcctggtgttcattatgtggaggcctatattccagacgccatctggtatgacttt
gaaaacgaaataaagattacagaacggaaagagggagttaaaatgtacctgcctgatgat
aaacttggtttacatctgagaggaggagccattctacctgtacaaagaccagacgtcaca
accacatacagtcggcgtcatcccatggggctgatcatcgctctggatgacaacaagtct
gcgtcaggagagctattttgggatgacggagactctcgagatactgtttcatctggaaat
cacattcattaccagttttcagtgactgatggctccttgacaatgcatgtcacaaagaat
ggatactcagatccaaacaacctgaagtttgagaacatcacaattttgggattcagctct
gctccaccttttgtgctggtgtcagacgggaccactagtaaccctttgcctcagtcacag
attcaatacgactctgtcaagcaggtgctgaatttgaggaatctggagctggaactcggg
aagtcatacactatcagctgggaggccaaagccgaaagaatcgactgctacccggaggag
ggtgccactaaggctgaatgtgaaggacgtggatgcatatgggagcctttagctgttccc
atgtgttattactcagagaaccatggctacaaagccagcaacgtggttgaaaatatgtat
ggcatcactgcagatttagagatcaatacagctttcccaagtcagcgttctcagtctcca
gacatcaacaagcttcgcgtggaaatcacattccatgatgaaatctgcctacggtggaag
atctacgatccagaaaaggcccgctatgaggtccctgttcccctcaacctgccaaaccca
cctccgttatggggtgagcaaacctataaggtggaaatcaacgaagagccatttgggatc
cgagtgataagaaaagacacatcagaagttatatttgattcggttctgccaggcttcatc
ttctcagatcagttcatccagatctccacacgtctccccaccgaatatgtctatggtttt
ggtgagacagagcatcccagctataaacatgacctcaactttcacacatatggactgttt
gccaaagaccagcctccagggtacaagctgaacagttacggaatccatcctttctacatg
ggcatggagaaaagtaaaaaggctcatggcatcctcctgctcaacagcaatgccatggta
tcggaacaaacaactcagtcactcaccggctccaaaactggtgcaggttttttgattggc
cgtccggttcttccagcctattggtcgcttggattccagctttgtcgctatggctacgcc
aacgattcggagatcgcagatctttacagagacatgagagctgctgagatcccctatgac
gttcagtatgcagatattgactatatggagaggcagatggacttcactctggacaaaact
aatttcctgggactgcctgctctggtggaccgcatgaggggagagggcatgcgtttcatt
ttcattctggacccggctatagcagccaatgagacgacagggtcctacgctgcatttgac
agcgggattgaaaaagacgttttcatcaaatggcctcctgcgctcagcaatgacattgtg
tggggaaaggtttggcctgactatcccaatatcaccgtggacaattctttggactgggat
actcaagtagagctcttcaggtctttcgtggcgttcccagatttcttcaagaacggtaca
gctgagtggtgggcggatcagattaaagactattacgacaacgtcatgaagtttgacggg
ctttggattgacatgaatgagccagccagtttcgtgcacggcactgttggaggaaaatgt
ctaggggatccccttctggaaaatcctccatacatgccaccactggagtccaaggaaaaa
ggtctgaaccataagactttatgcatgaacagcgagcagatccttgctgatggcacgcgc
gtcagacattatgacgttcacaacttgtacggcttatctcacaccaaacccacctacgat
gctttgcatagtaccaccggaaagagaggagttataattacccgctcaacatacccaacg
agtggacgctgggctggacattggctgggagacaactactctgcctgggaccagctcctc
aagtccatcataggcatgatggagttcagcatattcggcgtctcttacactggtgccgat
atctgtggcttctttaaccctgcccaaaaggagatgtgtctgcgctggatgcagctcgga
gctttctatcccttctccagaaaccacaacaccataaacatgccaagacaagacccagtg
gcctggggaccagagtttgccaatatgtctcgtgatgtgctgaatatccgctacaccctc
ctgccatacttgtacaccctgatgtatgaagcccacaccaaggggaccactgtggtcaga
ccaatgctgcacgagtttgtcaatgatgaaaagacatgggacattgataggcagttcctc
tggggttctgctcttctgatcacacctgctttggaagagggcgtcactgtggtcaaggga
tacctgccaaaaacccgctggtacgattaccacacgaatgaagttgtggaagggcaagga
cagtttgtggatatggacacacctttagacaaaattaacctgcatgtgagaggacgatac
atcattccctatcagaatccagagagaaacacacaactaagtcgtaagaatcctatgaac
ctgcttgttgctctggatggatcaggttatgcaactggtaacctgttttgggatgacgga
gaaggaattgatacccttaagaatagaaaatacatctataaacaattctctgcatcgagg
ggttccctttcgggtgtccgtgaaactgggctggaggaggccgacagacctttactgggc
gaagtgaaggtgttgggcgtatcatcatccgtcacggaggtcaccattactgtaactggg
ggcagtacaacacctttgactttcgattattaccctgagactcaggtgttgattattcat
gtaacaccgcagaaattcaaaattgatgagtatttcaacattgtctggaaatag

DBGET integrated database retrieval system