KEGG   Danio rerio (zebrafish): 100149276Help
Entry
100149276         CDS       T01004                                 

Gene name
usp43b
Definition
ubiquitin specific peptidase 43b
Orthology
K11856  
ubiquitin carboxyl-terminal hydrolase 43 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100149276 (usp43b)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100149276 (usp43b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 1183 aa AA seqDB search
MDKRDKKANKDSGSKSTKRTGKLFRRKSFKSVESLVSRILKSLGSLASGGETAERSDAED
DDGGFGESAPCAGNSVKKEDSSTSSSQVRKSSSLTSRSSAKERMFSLYGDKTPGVLGLKN
HGNTCFMNAVVQCLSNTDLLAEYLGLERYKRDVCHNGINGFIRNGNGQNEKGEVTERLAV
LVRALWTFQYTPQLSAEFKMTVSKYGAQFRGNSQHDALEFLLWLLDRLHEDSTSVVPNGN
NINKSKNKGQEGGDEKPGSDTLSPPQTQPGVRHSFVQEHFQAQYKSSLTCPHCLKQSNTF
DPFLCISLPIPLRQTRPVCVTLVFSSKGQRYLRVGLAVPLFGSLACLRRMVADEGKIAPD
QVILTEIYTTGFQRSFFDDDDLTIIAESDIIYAFQASPLYIRGGSARISGFHHSLPSSPY
SSSGPEGHRLAASGALSSEFLNQTDGMLKVLLLVCNAAGAGQQAVRFGPPFLMREDRSVS
WDQLQQSILSKLYYLMINGSQAHNFRVLFKIRVVGGSASYSYLNPQDGRPLFHPAVDRAL
KLCGSGGPPHVKLIVEWEHRIKDCLFGNIQEEVVKDSESVRAQQQHHVQQHSCTLDECFE
LYTKEEQLAPDDAWKCPHCKQLQQGTVQMSLWTLPDILILHLKRFRQVGERRNKLSTLVH
FPLTGLDMGRHMVQRTSCARAPPGWNKQAHRRPEASRYATDVLYDLYAVCNHHGGMHGGH
YTAYCRNSVDGQWYTYDDSSVEPLQEGEVCTRAAYILFYQRRDAIPSWSASCSRQGSSSS
SLSDHWLIRLNADEGISNSTSKVSNSSSAPEPQTPHSPVIHKSANEDNRDVAEATPFVRS
VRGQSMSMRYQSKSKTGSGKVLPLRWSFASKERRKPPSITSQNDNDELVEYLESGRRPRC
TKEPIVSIVASPSQVKGHLREDDSLSSPSCCSSLNGVERSSSQGPDSPKVPEGQSRPTSD
LNAVSSVDSRAKKCSKTTRQEHERTQASKSLQGSPTALSTGNSTSHSRDSTLKRLRNPAA
ATSRIHPSQILMATGESRGKDGIHPVSSTSQLQDGCSKEVGHGKTLSSKSLTKLSLSNGT
LNGKVVEVRKTGTVHKSTSKTNGRDTQVFSNTIDMKRAHSSSNIQNRLDMTLKRTLSLQR
NGPLVPASNKGLAVDKSSYATLQRIKYSSTSLGRQRPVPESCF
NT seq 3552 nt NT seq  +upstreamnt  +downstreamnt
atggataaacgcgacaaaaaggcgaataaagactcaggaagcaagtcgactaaacgcaca
gggaagctgttccggaggaaatcgtttaaatccgtggaaagtttggtgagtaggatcttg
aaaagtttgggaagcttagcaagcggcggagaaacagccgaacggtcggatgctgaggat
gatgacggagggtttggagaaagcgcaccttgcgcgggaaactcggtgaaaaaggaggac
agcagcaccagcagcagtcaggtgaggaaaagttcgtctcttaccagccgttcctccgcg
aaagagcgaatgttttcgctgtacggtgataaaaccccgggtgtgctgggtctgaagaac
cacgggaacacctgcttcatgaatgccgtcgtgcagtgcttaagcaacacagacctgctc
gctgaatatcttggtttggagcgatataaacgggatgtttgtcacaacggaataaacgga
tttataaggaacgggaacgggcagaacgagaaaggagaggtgacggagcggctcgcggtt
ttggtccgagcactttggacatttcagtacactcctcaactctctgctgagtttaagatg
acggtatctaaatatggtgctcagtttcgagggaattcccagcatgacgctctggaattc
ctgctctggcttttggaccgcctccatgaagactcaacttcagtcgtccccaatgggaat
aacataaacaaatcaaagaacaagggtcaagaaggaggtgatgaaaagcctggctctgat
accctgagccctcctcagacgcagcctggtgtacgtcacagctttgtacaagaacacttc
caggcacaatacaagtcatctctgacatgccctcattgtcttaagcagagcaacacgttt
gatccttttctgtgcatttctctccccattcctctaagacagacacgacctgtgtgtgtg
actttggtgttcagcagtaaagggcagcgctatctgagagtcgggcttgctgtgcctctg
ttcggctctttggcttgcctgcgcaggatggtagcagatgagggcaagatcgctcctgat
caggtgattttgacagagatctacacaacaggcttccagcgctcgttttttgatgacgat
gacttaaccatcatagcagagagtgacatcatctatgcctttcaagcttcacccctttac
atcaggggtggctctgcacgaatctcagggtttcaccacagtcttccgtcctctccgtac
tcctcgtctggtccggagggtcaccgtctggccgcgtccggtgctttgtcatctgagttc
ctgaaccaaaccgatgggatgctgaaggtcctgttgctggtgtgtaatgccgctggagca
ggacagcaggcagtgagattcggtcctccatttctcatgcgagaggacagatcagtatca
tgggatcagctccagcaaagcatcctcagcaaactctactatctcatgatcaacggctca
caggctcataatttcagggtgttgttcaagattcgtgttgttggaggatctgcatcttat
agctacttaaatcctcaagacggacggccgcttttccacccagcagtggacagagctctg
aaactgtgcggatcaggtggaccaccacatgtgaagctcattgttgaatgggagcacaga
atcaaagactgcctgtttggtaatatccaggaggaggtggtgaaggactcggaaagtgtt
cgtgctcaacaacaacaccacgttcagcaacacagctgcaccctggacgagtgctttgag
ctctacaccaaagaggaacaactggcccccgatgatgcgtggaagtgtcctcactgtaag
cagcttcagcagggcacggtgcagatgagcttatggacgctaccagacatcctaatcctc
cacctcaaacgcttccggcaggtgggagagcgcagaaacaagctctccactctcgtccac
ttccccctaacaggcctcgatatgggccgccacatggtccagagaaccagctgtgcccga
gcgccacctggctggaataagcaggcccatcgcaggcctgaagctagcagatatgcaacg
gacgtcctgtacgacctgtacgctgtgtgtaaccatcacggaggcatgcatggaggacac
tacacagcatactgcaggaactcggtggacggtcagtggtacacctatgatgacagcagt
gttgaacccttgcaggagggagaagtgtgcactcgcgctgcttatatcctcttctatcag
agacgtgatgccatcccttcttggtcagctagctgctcgcgacaaggttcctccagctca
tctctgtcagatcactggctcatccgattaaatgcagatgaaggaatttccaattcaacc
agcaaggtgtcaaattcatcttcggctcctgagcctcaaacccctcacagtcctgtcatc
cacaagtctgcaaatgaagacaacagagatgtagctgaagcaacaccatttgtacgaagc
gtccggggccagagtatgagcatgcgctaccagtccaaatccaagacgggttcaggaaaa
gttcttccactgcgttggtcgtttgcttccaaggagcgcagaaaaccccccagcatcact
tcacaaaatgataacgatgagctagtggagtaccttgaatctggccgacggccccgatgt
accaaggagcctatagtaagcatcgttgccagtccttcacaggtcaaaggccaccttcgt
gaagatgattccctgagttcccccagctgttgcagcagtctcaatggtgtggagagaagt
agctctcaaggcccggattctccaaaagtgcctgaaggccagagtagaccaacttcagat
cttaatgctgtcagttctgtcgactcgagagcaaaaaaatgctcaaaaacaacccggcag
gagcacgaaaggactcaggctagtaagtcacttcaaggttctcctactgcactttccact
ggtaacagtacatctcattccagagactccacactgaaacggcttcgaaacccggcagct
gcaactagcagaattcatcccagtcagattctgatggccacaggagaaagcagaggtaaa
gatggcatccatcccgttagcagcacctctcagctccaggatgggtgctctaaggaggtg
ggtcatggaaaaacactgtctagtaagagcttgaccaaactctcgttgtccaatggcact
ttgaatgggaaggtcgttgaggtgaggaaaactggtactgttcacaagagcacaagtaaa
acaaatggcagagacacccaggttttttcaaacactattgatatgaaacgtgcccacagc
tcttcaaatattcaaaacaggctagatatgactttaaaaaggacgttatctctccaaaga
aatggtcccctggtgccagcttccaacaaaggacttgcagttgataaatcctcctatgca
acactacagagaatcaaatacagcagcacttcacttggcaggcagagacctgtgcccgag
tcttgcttctga

DBGET integrated database retrieval system