KEGG   Danio rerio (zebrafish): 100150054Help
Entry
100150054         CDS       T01004                                 

Gene name
cyp1b1, CYP1B, zgc:136223
Definition
cytochrome P450, family 1, subfamily B, polypeptide 1 (EC:1.14.14.1)
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:dre00140]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:dre00380]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:dre00980]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
13
AA seq 526 aa AA seqDB search
MMDVLLALRDLLQLSTRSVLLSLMVCLMLMFRRRQLVPGPFSWPVIGNAAQLGNTPHFYF
SRMAQKYGDVFQIKLGSRNVVVLNGDAIKEALVKKATDFAGRPDFASFRFVSNGKSMAFG
NYTPWWKLLRKVAQSTVRNFSTANIQTKQTFEKHIVSEIGELIRLFLNKSREQQFFQPHR
YLVVSVANTMSAVCFGNRYAYDDAEFQQVVGRNDQFTKTVGAGSMVDVMPWMQYFPNPIR
TLFDQFKELNKEFCAFIELKVSEHRKTISPSHVRDMTDAFIVALDKGLSGGSGVSLDKEF
VPPTISDIFGASQDTLSTALQWIILLLVRYPEIQNRLQEDVGRVVDRSRLPTIADQPHLP
YLMAFIYEVMRFTSFTPLTIPHSTTKDTSINGYPIPKDTVIFVNQWSLNHAPAKWDQPEV
FNPQRFLDEDGSLNKDLTTNVLIFSLGKRRCIGEDVSKIQLFLFTSVLVHQCSFKAESTP
NMDYEYGLTLKPKPFKVSVTARDSSDLLDSLVGTSQTPTEKRLKCN
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgtcctgctggctctgagagaccttcttcagctgtcaacacggagtgtgttg
ctgtcgctgatggtgtgtttaatgctcatgttccggcgtcggcagctggtaccgggtccg
ttctcgtggccggtcatcggcaacgccgctcagctcggtaacactcctcacttttacttc
agccgaatggctcagaaatacggcgacgtgtttcagatcaaactgggcagcagaaatgtg
gtggttctaaacggagacgcgatcaaagaggcgctcgttaaaaaagcgaccgattttgca
ggcagacccgactttgcttcattccggttcgtgtctaacgggaaaagcatggctttcggt
aactacaccccttggtggaaactgctccggaaagtcgcgcagagcaccgtcagaaatttc
tccacagccaacatccaaaccaagcagacattcgagaagcacatcgtaagcgagatcgga
gagctcatccgtctttttctcaataaatcccgcgagcagcagtttttccagccgcaccgg
tatttagtggtgtcggtggcgaacacgatgagcgccgtgtgctttgggaaccggtacgcg
tacgatgacgcggagttccagcaggtggtgggcagaaacgaccagttcaccaaaacagtc
ggagccgggagcatggtggatgtgatgccctggatgcagtacttcccaaaccccatcaga
accctctttgaccagtttaaagagctcaacaaggagttttgcgcgttcattgaattgaaa
gtttcggagcaccgaaagaccatttcaccgagccacgtccgtgatatgactgatgccttc
atcgtcgctctggacaaggggctgtccgggggctcgggggtctctctggataaggagttt
gtgccaccgaccatctcagatattttcggggccagtcaagacactctgtctacagctctc
cagtggatcatcctgctacttgtcaggtatccagaaatccagaaccgtctccaggaggac
gtgggcagggtagtggatcgcagtcgtcttccaaccatcgcagaccagcctcatcttcca
tacctgatggccttcatctatgaagtcatgcgatttacttcattcacccctttgacgatt
ccccacagcacgaccaaagacacatccatcaacggttaccccattcccaaagacacagtc
atttttgtcaaccaatggtctttgaatcacgccccagcaaaatgggatcaacctgaggtg
ttcaacccacagcgctttctagatgaggacggatccctcaacaaagacctgaccaccaac
gtgctcatcttctcactcggcaagcgaagatgcattggagaagacgtgtcaaaaatacag
cttttcctcttcacgtctgtgctggtccatcagtgtagttttaaagctgaaagcactcct
aatatggactacgaatacgggcttacactcaaacccaaaccttttaaagtgtctgtcaca
gctcgcgacagctcagacctgctggacagcttggtaggaacatctcagactccaacagaa
aagagactgaaatgtaattga

DBGET integrated database retrieval system