KEGG   Danio rerio (zebrafish): 100150054Help
Entry
100150054         CDS       T01004                                 

Gene name
cyp1b1, CYP1B, zgc:136223
Definition
cytochrome P450, family 1, subfamily B, polypeptide 1 (EC:1.14.14.1)
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100150054 (cyp1b1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    100150054 (cyp1b1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100150054 (cyp1b1)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100150054 (cyp1b1)
Cytochrome P450 [BR:dre00199]
 Cytochrome P450, animal type
  CYP1 family
   100150054 (cyp1b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
13
AA seq 526 aa AA seqDB search
MMDVLLALRDLLQLSTRSVLLSLMVCLMLMFRRRQLVPGPFSWPVIGNAAQLGNTPHFYF
SRMAQKYGDVFQIKLGSRNVVVLNGDAIKEALVKKATDFAGRPDFASFRFVSNGKSMAFG
NYTPWWKLLRKVAQSTVRNFSTANIQTKQTFEKHIVSEIGELIRLFLNKSREQQFFQPHR
YLVVSVANTMSAVCFGNRYAYDDAEFQQVVGRNDQFTKTVGAGSMVDVMPWMQYFPNPIR
TLFDQFKELNKEFCAFIELKVSEHRKTISPSHVRDMTDAFIVALDKGLSGGSGVSLDKEF
VPPTISDIFGASQDTLSTALQWIILLLVRYPEIQNRLQEDVGRVVDRSRLPTIADQPHLP
YLMAFIYEVMRFTSFTPLTIPHSTTKDTSINGYPIPKDTVIFVNQWSLNHAPAKWDQPEV
FNPQRFLDEDGSLNKDLTTNVLIFSLGKRRCIGEDVSKIQLFLFTSVLVHQCSFKAESTP
NMDYEYGLTLKPKPFKVSVTARDSSDLLDSLVGTSQTPTEKRLKCN
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgtcctgctggctctgagagaccttcttcagctgtcaacacggagtgtgttg
ctgtcgctgatggtgtgtttaatgctcatgttccggcgtcggcagctggtaccgggtccg
ttctcgtggccggtcatcggcaacgccgctcagctcggtaacactcctcacttttacttc
agccgaatggctcagaaatacggcgacgtgtttcagatcaaactgggcagcagaaatgtg
gtggttctaaacggagacgcgatcaaagaggcgctcgttaaaaaagcgaccgattttgca
ggcagacccgactttgcttcattccggttcgtgtctaacgggaaaagcatggctttcggt
aactacaccccttggtggaaactgctccggaaagtcgcgcagagcaccgtcagaaatttc
tccacagccaacatccaaaccaagcagacattcgagaagcacatcgtaagcgagatcgga
gagctcatccgtctttttctcaataaatcccgcgagcagcagtttttccagccgcaccgg
tatttagtggtgtcggtggcgaacacgatgagcgccgtgtgctttgggaaccggtacgcg
tacgatgacgcggagttccagcaggtggtgggcagaaacgaccagttcaccaaaacagtc
ggagccgggagcatggtggatgtgatgccctggatgcagtacttcccaaaccccatcaga
accctctttgaccagtttaaagagctcaacaaggagttttgcgcgttcattgaattgaaa
gtttcggagcaccgaaagaccatttcaccgagccacgtccgtgatatgactgatgccttc
atcgtcgctctggacaaggggctgtccgggggctcgggggtctctctggataaggagttt
gtgccaccgaccatctcagatattttcggggccagtcaagacactctgtctacagctctc
cagtggatcatcctgctacttgtcaggtatccagaaatccagaaccgtctccaggaggac
gtgggcagggtagtggatcgcagtcgtcttccaaccatcgcagaccagcctcatcttcca
tacctgatggccttcatctatgaagtcatgcgatttacttcattcacccctttgacgatt
ccccacagcacgaccaaagacacatccatcaacggttaccccattcccaaagacacagtc
atttttgtcaaccaatggtctttgaatcacgccccagcaaaatgggatcaacctgaggtg
ttcaacccacagcgctttctagatgaggacggatccctcaacaaagacctgaccaccaac
gtgctcatcttctcactcggcaagcgaagatgcattggagaagacgtgtcaaaaatacag
cttttcctcttcacgtctgtgctggtccatcagtgtagttttaaagctgaaagcactcct
aatatggactacgaatacgggcttacactcaaacccaaaccttttaaagtgtctgtcaca
gctcgcgacagctcagacctgctggacagcttggtaggaacatctcagactccaacagaa
aagagactgaaatgtaattga

DBGET integrated database retrieval system