KEGG   Danio rerio (zebrafish): 100150090Help
Entry
100150090         CDS       T01004                                 

Gene name
sphk2, si:dkey-40m6.13
Definition
sphingosine kinase 2
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dre  Danio rerio (zebrafish)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100150090 (sphk2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100150090 (sphk2)
   04020 Calcium signaling pathway
    100150090 (sphk2)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100150090 (sphk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
16
AA seq 869 aa AA seqDB search
MRSPGPDSPSMTEEALLHGQFGGWSSGGGSGSNSNSCPNSPGGVSLPSSPASTNYALTLT
PTHIHVQRLSPRAGKQSRLLLPMAELTGCSCPRSPAPPLLVLYWYPPGRRRKGVSRHRQV
RAYLAESRAEAEKWNAAIQSLLRGMDVSSTTEFCKSMLPRPRRLLLLVNPFSGRGQAMQW
CQTHILPMIREANISYNLIQTERQNHARELIREISLPEWDGIVIVSGDGLLHEVINGLME
RPDWEQAIKTPVGILPCGSGNALAGSINHHAGYDMCLREPLLLNCCFLLCRGGVKPLDLV
SVTTSPCASSSTSNQNGHPPAPRRLFSFLSVAWGFVSDVDIESERYRGLGSARFTLGTLV
RLASLRSYKGRLSYLPPAVVNPSPDATPQPPRRPLSRSITEGLEGFCRTPIHRTCSDMGL
SEQRSLRKDDGERERERERERQERERERERRRDRARGVGVVRASSLAEDREREVEAEEKM
EEMSGTSSESTERDECDNIAKNNGNEEENNSGKSKIDGQELTNARNLSDTNEVNDCDGSY
QTTPPELQHALRKNSAPSSQIINAFFSQPIGADTDQDLELAAYGKEDEDINGTYFQKEAY
SLDKSRERALTISSSPFRQSPFKAFKPKTLDQNQNPSRPRPLSLLHQSHSNSLPPKFPSL
SLSLSPTPPSSPSCASPHSSYLAPRPNTPSSSSPSPSIHSPTPSFNFDLAEPAGPLKNRP
HMTSSINLPEDDLLPPLDQPLPTRDWVTIEGDFVLVLAIYQSHLGADLLAAPQARFDDGL
IHLTFVRAGISRATLLRLFLAMERGAHLSLSSPYVSHVSARAFRLQPLSPRGTLTVDGEL
VPYGPLQAQVHPSMARLIVGDSGIKITRF
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctcctggcccagacagcccgtccatgactgaggaagcattgctgcatggacag
tttggtggttggagtagtggaggcggcagtggaagtaacagcaacagctgccctaacagt
cctggaggtgtgtctttaccttccagccctgcctccactaactacgccttgaccctcacg
ccaactcacatccatgtccagcggttgtctccacgtgcagggaagcagtccaggttgctt
ctgcctatggcagagctgaccggatgcagctgcccacgctcaccagcccctcccttacta
gtgctttactggtaccctccgggacgccgccggaagggtgtttctagacacagacaggtg
agggcgtatttggcagagagccgagctgaggcggagaaatggaacgctgctatacagagc
ctgctgagggggatggacgtcagctccactacagaattttgcaaaagcatgttgcctcgt
ccccgtcgactgttgctgctggtcaatccattcagtggccggggtcaggcaatgcaatgg
tgtcaaacgcacatacttccaatgataagagaagctaacatcagctataacctcatacag
acagagcgtcagaatcacgcacgtgagctaatcagagagatctcactaccagaatgggat
ggaatcgtcattgtgtctggagatggacttttgcatgaggtgataaatggccttatggaa
aggccagattgggaacaagcaataaaaactcctgtgggaattctgccttgtggctctgga
aatgcacttgctggttccatcaaccaccatgctggatatgacatgtgcctacgggagcct
ctcctcctcaactgctgttttctgctgtgccgaggtggggttaaaccgttggacttggtc
tctgttacaaccagcccgtgtgcttcatcatccacgtctaatcaaaatgggcatccacct
gctcccaggaggcttttctctttcctttctgtggcttggggttttgtttctgatgtggac
atagagagcgaacgctacagagggctgggctcagctcgttttacactgggaacactagtg
agattggcttctctgcgctcttataagggtcgcctttcctacctgcctcctgctgtagtc
aacccgtcccctgatgccacacctcagccaccccggaggcccctgtcgcgcagtattact
gaaggtctggagggattttgtcgcacacccatccaccgcacatgctctgacatgggcctg
agtgaacaaagaagtctccgaaaagatgatggagaaagagagagggaaagagagcgggaa
agacaggagagagagcgggagagggaaaggaggagagacagggcaagaggggttggggta
gtgagagccagcagtctcgcagaagaccgggagagagaggtagaagcagaagagaaaatg
gaggagatgtctggcaccagctctgagtcaactgaaagggatgaatgtgacaacatagcc
aagaataatggtaacgaagaagaaaataattcaggaaagagtaagatagatggccaagag
ttgacaaatgcaagaaatttaagtgacacaaatgaagtaaatgactgtgacggaagttat
cagacaacaccacctgaactgcaacatgcattacgtaaaaactcggctccctctagccaa
ataattaatgccttcttcagccaaccgattggtgcagacactgaccaagacttggagctg
gcagcctatggcaaggaggatgaggacataaatggcacttattttcagaaagaggcatat
tcattggacaagtctcgcgagcgagccctcactatctcatcctctccattccgtcagtct
cctttcaaagctttcaagcccaaaactttggaccagaaccagaacccttcaaggccaagg
cccctctctcttctccaccaatcccattcaaactctctccctccgaaatttccatccctt
tctctgtccctttctccaacccctccttcatctccatcttgtgcctctccacactcttct
tatctcgcaccacgtcccaacactcccagctcatcttctccatccccttctattcattca
ccaactccttccttcaactttgacctagcagagcctgcaggacccctaaaaaaccgacct
cacatgacatcctccatcaaccttccagaggatgatttgctacctcctctggaccagcct
ctccctacaagggactgggttactattgaaggtgattttgtcctggttcttgccatctac
cagtcccacctgggagcagaccttcttgctgcgcctcaggctcggtttgatgatggcttg
atccatctgacatttgtgcgggctggcatctcccgagcaacactacttagactgttccta
gcaatggagagaggagcccatctgtctcttagctctccctatgttagtcacgtttctgct
cgggcgttccgccttcagccactttccccacgaggaacccttactgtagatggagagctg
gtgccctatgggccactgcaggcacaggttcatccctccatggctcgtttgattgttggg
gactctggaataaagattacaagattctga

DBGET integrated database retrieval system