KEGG   Danio rerio (zebrafish): 100150090Help
Entry
100150090         CDS       T01004                                 

Gene name
sphk2, si:dkey-40m6.13
Definition
sphingosine kinase 2
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dre  Danio rerio (zebrafish)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dre00600]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:dre04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:dre04020]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
16
AA seq 869 aa AA seqDB search
MRSPGPDSPSMTEEALLHGQFGGWSSGGGSGSNSNSCPNSPGGVSLPSSPASTNYALTLT
PTHIHVQRLSPRAGKQSRLLLPMAELTGCSCPRSPAPPLLVLYWYPPGRRRKGVSRHRQV
RAYLAESRAEAEKWNAAIQSLLRGMDVSSTTEFCKSMLPRPRRLLLLVNPFSGRGQAMQW
CQTHILPMIREANISYNLIQTERQNHARELIREISLPEWDGIVIVSGDGLLHEVINGLME
RPDWEQAIKTPVGILPCGSGNALAGSINHHAGYDMCLREPLLLNCCFLLCRGGVKPLDLV
SVTTSPCASSSTSNQNGHPPAPRRLFSFLSVAWGFVSDVDIESERYRGLGSARFTLGTLV
RLASLRSYKGRLSYLPPAVVNPSPDATPQPPRRPLSRSITEGLEGFCRTPIHRTCSDMGL
SEQRSLRKDDGERERERERERQERERERERRRDRARGVGVVRASSLAEDREREVEAEEKM
EEMSGTSSESTERDECDNIAKNNGNEEENNSGKSKIDGQELTNARNLSDTNEVNDCDGSY
QTTPPELQHALRKNSAPSSQIINAFFSQPIGADTDQDLELAAYGKEDEDINGTYFQKEAY
SLDKSRERALTISSSPFRQSPFKAFKPKTLDQNQNPSRPRPLSLLHQSHSNSLPPKFPSL
SLSLSPTPPSSPSCASPHSSYLAPRPNTPSSSSPSPSIHSPTPSFNFDLAEPAGPLKNRP
HMTSSINLPEDDLLPPLDQPLPTRDWVTIEGDFVLVLAIYQSHLGADLLAAPQARFDDGL
IHLTFVRAGISRATLLRLFLAMERGAHLSLSSPYVSHVSARAFRLQPLSPRGTLTVDGEL
VPYGPLQAQVHPSMARLIVGDSGIKITRF
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctcctggcccagacagcccgtccatgactgaggaagcattgctgcatggacag
tttggtggttggagtagtggaggcggcagtggaagtaacagcaacagctgccctaacagt
cctggaggtgtgtctttaccttccagccctgcctccactaactacgccttgaccctcacg
ccaactcacatccatgtccagcggttgtctccacgtgcagggaagcagtccaggttgctt
ctgcctatggcagagctgaccggatgcagctgcccacgctcaccagcccctcccttacta
gtgctttactggtaccctccgggacgccgccggaagggtgtttctagacacagacaggtg
agggcgtatttggcagagagccgagctgaggcggagaaatggaacgctgctatacagagc
ctgctgagggggatggacgtcagctccactacagaattttgcaaaagcatgttgcctcgt
ccccgtcgactgttgctgctggtcaatccattcagtggccggggtcaggcaatgcaatgg
tgtcaaacgcacatacttccaatgataagagaagctaacatcagctataacctcatacag
acagagcgtcagaatcacgcacgtgagctaatcagagagatctcactaccagaatgggat
ggaatcgtcattgtgtctggagatggacttttgcatgaggtgataaatggccttatggaa
aggccagattgggaacaagcaataaaaactcctgtgggaattctgccttgtggctctgga
aatgcacttgctggttccatcaaccaccatgctggatatgacatgtgcctacgggagcct
ctcctcctcaactgctgttttctgctgtgccgaggtggggttaaaccgttggacttggtc
tctgttacaaccagcccgtgtgcttcatcatccacgtctaatcaaaatgggcatccacct
gctcccaggaggcttttctctttcctttctgtggcttggggttttgtttctgatgtggac
atagagagcgaacgctacagagggctgggctcagctcgttttacactgggaacactagtg
agattggcttctctgcgctcttataagggtcgcctttcctacctgcctcctgctgtagtc
aacccgtcccctgatgccacacctcagccaccccggaggcccctgtcgcgcagtattact
gaaggtctggagggattttgtcgcacacccatccaccgcacatgctctgacatgggcctg
agtgaacaaagaagtctccgaaaagatgatggagaaagagagagggaaagagagcgggaa
agacaggagagagagcgggagagggaaaggaggagagacagggcaagaggggttggggta
gtgagagccagcagtctcgcagaagaccgggagagagaggtagaagcagaagagaaaatg
gaggagatgtctggcaccagctctgagtcaactgaaagggatgaatgtgacaacatagcc
aagaataatggtaacgaagaagaaaataattcaggaaagagtaagatagatggccaagag
ttgacaaatgcaagaaatttaagtgacacaaatgaagtaaatgactgtgacggaagttat
cagacaacaccacctgaactgcaacatgcattacgtaaaaactcggctccctctagccaa
ataattaatgccttcttcagccaaccgattggtgcagacactgaccaagacttggagctg
gcagcctatggcaaggaggatgaggacataaatggcacttattttcagaaagaggcatat
tcattggacaagtctcgcgagcgagccctcactatctcatcctctccattccgtcagtct
cctttcaaagctttcaagcccaaaactttggaccagaaccagaacccttcaaggccaagg
cccctctctcttctccaccaatcccattcaaactctctccctccgaaatttccatccctt
tctctgtccctttctccaacccctccttcatctccatcttgtgcctctccacactcttct
tatctcgcaccacgtcccaacactcccagctcatcttctccatccccttctattcattca
ccaactccttccttcaactttgacctagcagagcctgcaggacccctaaaaaaccgacct
cacatgacatcctccatcaaccttccagaggatgatttgctacctcctctggaccagcct
ctccctacaagggactgggttactattgaaggtgattttgtcctggttcttgccatctac
cagtcccacctgggagcagaccttcttgctgcgcctcaggctcggtttgatgatggcttg
atccatctgacatttgtgcgggctggcatctcccgagcaacactacttagactgttccta
gcaatggagagaggagcccatctgtctcttagctctccctatgttagtcacgtttctgct
cgggcgttccgccttcagccactttccccacgaggaacccttactgtagatggagagctg
gtgccctatgggccactgcaggcacaggttcatccctccatggctcgtttgattgttggg
gactctggaataaagattacaagattctga

DBGET integrated database retrieval system