KEGG   Danio rerio (zebrafish): 100150238Help
Entry
100150238         CDS       T01004                                 

Definition
si:ch73-95l15.3
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dre  Danio rerio (zebrafish)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100150238
  Lipid metabolism
   00062 Fatty acid elongation
    100150238
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100150238
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100150238
Lipid biosynthesis proteins [BR:dre01004]
 Fatty acid synthase
  Component type
   100150238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
Position
15
AA seq 320 aa AA seqDB search
MAKHHLRNKLQLYRDRCPTLECLAKAVVAMTDGCRPCVFIWAVLLLLPTVIMAYRPVILV
HGLFGGPEQMATLKKYIKRSHPGTSVTAISLYDGDASVKPMWEQVDGFRKAIKPIMERAK
DGVHLICFAQGGLICRGVLATLPHHNVHSLILVSSPLAGHYGDSKYISKFFPSLSKSTLY
NACYTTQGQKRSSCSYWKDPHQIEKYLKYSVFLAPLNGEVKNAKSKAWRKNFLRIKTMVL
LGGPDNEVIKPWQSSMFGFYDSDENVIDMEHQDFYVNDAFGLKTLNRREAIVKCIVPGVK
HNAWPKNHKIYKKCIEKWLT
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacatcacctgaggaacaaattacagctgtatcgcgaccgatgcccaactctt
gagtgtcttgctaaggctgttgtcgcgatgactgacggctgtagaccatgtgttttcatc
tgggctgtgttgctgctgctgcccacagtcatcatggcgtacagaccagtgattcttgtt
cacgggctcttcggtggacctgaacagatggcgacgttgaagaaatatattaaacggtct
catccaggtaccagtgtgactgcaatatctctgtatgatggcgatgccagcgtaaagcca
atgtgggaacaggtggatggatttcgaaaggccatcaaacccatcatggaaagagctaaa
gacggcgtccatctcatctgctttgcacaaggtggtttgatatgtcgaggagttcttgct
actcttcctcatcacaatgttcactctctgatattggtgtcttcaccactagctggccat
tatggagattcaaaatacatcagcaagtttttcccttcgttgagcaagtcaacactgtac
aatgcttgttatactacacaaggacaaaaaagatcaagctgtagctactggaaagatcct
catcaaattgaaaaatacttgaagtacagcgtctttctagccccgctgaatggagaagta
aaaaatgccaagtcaaaagcatggcgcaaaaattttctgcgcataaagaccatggtgttg
ctcggcggaccagataatgaagtcattaaaccatggcaatcaagtatgtttgggttttat
gacagcgatgaaaatgtgatcgatatggagcatcaggatttttatgtgaatgatgccttt
ggcctgaaaacactgaaccgaagagaagccattgtgaagtgtatcgtccctggtgttaaa
cataatgcctggcctaaaaaccacaaaatctacaagaaatgcattgaaaagtggctcacg
taa

DBGET integrated database retrieval system