KEGG   Danio rerio (zebrafish): 100150701Help
Entry
100150701         CDS       T01004                                 

Gene name
chrm4a
Definition
cholinergic receptor, muscarinic 4a
Orthology
K04132  
muscarinic acetylcholine receptor M4
Organism
dre  Danio rerio (zebrafish)
Pathway
Neuroactive ligand-receptor interaction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100150701 (chrm4a)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100150701 (chrm4a)
G protein-coupled receptors [BR:dre04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    100150701 (chrm4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
7
AA seq 513 aa AA seqDB search
MNVTNSTGAEGLAPWNFNGSLSNVSSDANFSCDSGSANGSCAAVEGDGESPYKTVEMVFI
ALVTGSLSFVTVVGNILVMLSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTVYIIK
GYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLSYPTRRTTKMAGLMIAS
AWILSFILWAPAILFWQFIVGARTVAPGECYIQFLSNPAVTFGTAIAAFYLPVVIMTVLY
VHISLASRSRVSKQKPEAKKEKKAQKSSGLLKSHILKQNNNNQSPPKPSLDTCSTVDTMK
NGKLEESVVSAKADSCVQAEEKESSNDSSTASIAPKEPKERANSEVTSDAGLTPAPAAAP
KLNPQSKWSKIKIVTKQAGDECITAIEIVPPNSTGESRSIPVSRPRTVARKFASIARSQV
KRKRQMAAREKKVTKTIFAILLAFIITWTPYNVMVLISTFCQSCVPDTVWAIGYWLCYVN
STINPACYALCNATFKKTFKNLLMCQYKNIGTR
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaactaacagcactggagcagagggactcgcgccctggaacttcaacggctct
ttgagcaacgtgtccagtgatgccaacttcagctgtgacagtggcagcgccaatggctca
tgtgcagcggttgagggcgacggcgagagcccgtacaagacggtggagatggtcttcatc
gcactggtcactggatctctcagtttcgtcaccgtcgtgggcaacatcctcgtcatgctc
tcaatcaaggttaatcgacacctgcagacggtcaacaactacttccttttcagcctggcc
tgtgcagatctgatcatcggtgtgttctccatgaacctttacaccgtctacatcattaag
ggttactggccgcttggcccagtggtgtgtgacctgtggctcgcgctggattacgtggtc
agcaacgcttcagtcatgaacctgctaatcatcagcttcgaccgatacttctgtgtgacc
aaacccttgagctaccccacacgcagaaccaccaagatggccggcctcatgattgcctct
gcctggatcctgtccttcatcctgtgggctcccgctatcctgttctggcagtttatcgtc
ggagcccgaaccgtagcacctggggaatgttacatccagttcctttccaaccccgcggtc
acatttggcacagccatcgctgcgttctaccttccggtggtcatcatgacagtcctttat
gtgcacatctctctggcaagccgcagtcgtgtgtccaaacagaagcctgaagccaagaaa
gagaagaaagcccagaaatctagcggcctgctcaagagtcacatcctaaagcagaacaac
aataaccagtctcctcctaagcccagcctggacacctgctctacagtggacaccatgaaa
aacggtaaactggaagagtctgtggtgtccgctaaagcagactcttgcgtgcaggcggag
gaaaaggaaagctccaatgattccagcacagccagcatagcgccaaaggagcccaaagag
cgagcgaacagtgaggtcacttcagacgcaggtctgacccctgcgccagcagctgcacct
aaactcaaccctcaatccaaatggtccaagatcaagatagtcaccaaacaggcaggagat
gagtgcatcacagcaattgagatcgtcccaccgaacagcaccggcgagagccgctccatc
cctgtgagccgtccccgcactgtggcgcgcaagtttgccagcattgcacgcagtcaggtg
aagaggaaacggcaaatggcggcacgagaaaagaaagtgacaaagacaatctttgccatc
ctgctggcctttatcatcacatggacgccgtacaatgtaatggttttaattagcacgttc
tgccagtcgtgtgttccagacacagtctgggccattggctactggctctgctacgtcaac
agcaccatcaaccccgcttgctatgcactatgtaacgccactttcaaaaagaccttcaaa
aacctgctcatgtgccagtataagaacatcggcaccagatga

DBGET integrated database retrieval system