KEGG   Danio rerio (zebrafish): 100330410Help
Entry
100330410         CDS       T01004                                 

Gene name
alp3
Definition
alkaline phosphatase 3 (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100330410 (alp3)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100330410 (alp3)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100330410 (alp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
2
AA seq 534 aa AA seqDB search
MFAVRVSVVCFLLTITSGSVEEENPEFWRKSAQNTLRSALSRKINTNVAKNIVLFLGDGM
GVTTITAARILKGQLQKHSGEETVMNMDTFPNVGLAKVYSVDFQIPDSAATATAYLCGVK
TNLNTVGVSAAARNGVCRSQKGNEVTSILRWAKDAGKSVGIVTTTRVQHATPAASFAHSA
SRTWYSDADLPASAATEGCVDIATQLLHNIDIDVIIGGGRKYMTPKGFPDPEYPSDASAQ
GQRRDGRNLIQDWIQMKEGKVARYVWNKTDFDAVDPEKTDYLMALFEPADLRFDVERDHS
MDPSISETTDKAIQILKKNPKGFFLLVEGGRIDQGHHSSRASAALHEAVALDEAVSRGLE
LTDEEETLTIVTADHSHAFTFNGYPFRGNSILGKSPIFASDFLPYTTLMYGNGPGHKITN
NKRPDIRKVDTADKDYIQQSAVPLDSETHGGEDVAVFARGPMAHLFQGVYEQNYIPHAMA
YAACIGENQQHCAITAKPDENPDTSTDPGNSAQNMPDYTFTILMISTLMRILLH
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctgtccgtgtgtccgtcgtctgttttctgctgaccatcacttctggatcagtt
gaagaggagaatccagagttctggaggaagtcggctcaaaacacactgcgttcggctctg
agccggaaaatcaacactaatgtggccaaaaacattgtgctgtttctgggagacggtatg
ggagtgacgaccatcacagccgcgcggatcctgaagggtcagttacagaaacactcaggc
gaggagaccgtcatgaatatggacacattccccaatgtgggtcttgcgaaggtgtattca
gtggattttcagattcctgacagcgcagcgacggctacagcgtatctgtgcggagtcaaa
accaacctgaacactgtgggtgtgagcgcagcagcacgtaacggagtgtgtcgatcacag
aagggcaacgaggtcacgtccatcctcagatgggccaaagacgcaggtaagtcagtagga
atagtaacgacgactcgtgtccagcatgcgactccagcagcttcattcgctcacagcgcc
agcaggacctggtacagcgatgcggatctgcctgcgtctgcagctactgaaggctgtgtg
gacatcgctacacaactactacacaacatcgatattgacgtgatcatcggaggaggccgt
aagtacatgacacctaaaggtttccccgatccagagtatccgtcagacgcgagtgctcag
ggccagcggagagacggcagaaacctcattcaggactggatacagatgaaggaaggaaag
gttgccagatatgtgtggaataagacagattttgacgctgtggatcctgaaaagactgat
tatctgatggctctgtttgagccggctgatctgaggtttgatgtggagcgagatcacagc
atggacccctccatctctgaaaccaccgacaaagccattcagatcctcaagaaaaacccc
aaaggattcttcctgctggtcgaaggtggtcgtattgatcagggtcatcactccagtcgg
gcgtcagccgctctgcatgaagctgtggctctggatgaggcggtttctcgtggactggag
ctcactgatgaagaggagacgctgaccatcgtcactgctgaccactcacacgcattcact
ttcaacggataccctttcagaggaaacagcattctgggtaaatctccaatcttcgcctct
gactttttaccatacacaacactgatgtacgggaatggtccgggacacaaaatcaccaac
aacaagcgtccagacatacgcaaagttgacactgccgataaggactacatccagcagtcg
gccgtcccgctggactcagagacccacgggggtgaggatgtggcagtgttcgctcgcggg
cccatggcacatctcttccagggcgtttatgagcagaactacatcccgcacgccatggct
tacgccgcatgcattggtgaaaatcagcaacactgcgctattactgcaaaaccagacgaa
aacccagacacatccactgacccgggaaactctgcccaaaacatgcccgactataccttc
accatcctgatgatcagcacactgatgaggattttactgcactga

  All links  
No link information was found.   
DBGET integrated database retrieval system