KEGG   Danio rerio (zebrafish): 100330650Help
Entry
100330650         CDS       T01004                                 

Definition
alpha-2B adrenergic receptor-like
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
dre  Danio rerio (zebrafish)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100330650
G protein-coupled receptors [BR:dre04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    100330650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 431 aa AA seqDB search
MNYSSCNSSSSRYSPEITAVFAITMTLIMLFTIFGNIMVIIAVLTCRSLRGPQNLFLVSL
AAADILVATLVIPFSLAKELMGCWYFESLWCEIILALDVLFCTSSIIHLCAISLDRYLSI
SRPVQYGTQRTPRKIKGAIVVVWLISAIISFPPLVSMDKPQQAKGDPRTTCELNEDKWYI
LYSTIGSFFAPCLIMILVYVRIYQIAKKHTRCPPGEPRKDSAVGRELQNGKDGGVDSANN
PNIAPSKSEAVKQPPVITESAQKTKRSRRCKENKEESSSSGSDVEVVGGHDANGTNSNMA
PLETVNKTPAQSQSYRNIIATSKGSQLANAKATGTPNTRRKAMIVREKRFTFVLAVVIGV
FIICWFPFFFSYSLQAICPDMCKVPEGLFTFFFWIGYCNSALNPLIYTIFNRDFRKAFKK
ILCKRCKDCSF
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaattattccagttgcaattccagctcgtcccggtattcccctgaaataaccgcggtg
tttgccatcacaatgactctcatcatgctcttcaccatcttcgggaacatcatggtgatc
atcgcagtcctcacctgccgctctttgcgaggacctcaaaatcttttcttggtgtctctg
gcagcggctgacattttggtggccactttagtcatcccgttctccctggctaaagaatta
atgggttgctggtacttcgagtcattgtggtgcgagatcatcctggcattagatgtgctt
ttttgcacatcctccatcattcacctgtgcgccatcagcctggaccgctacctgtctata
tcccgacctgtgcagtatggcacccagcgcactcctcgaaaaattaaaggcgccattgtt
gttgtatggcttatttctgccatcatctccttcccgccattggtctccatggataaaccc
cagcaagcgaagggtgacccgcgaacaacatgcgaactcaatgaggacaaatggtatatt
ctgtactccaccattgggtcattcttcgccccatgcctcatcatgatcctggtttacgtt
cgcatctatcagattgccaagaaacacacaagatgtcctccaggagagccgaggaaagac
agtgcagtgggacgggagcttcagaatggcaaagatggaggtgttgactccgcaaacaat
cccaatatagctccatccaaatctgaagccgtaaaacagcctccggtgataacagaaagt
gctcagaagacgaaacgctcaagaagatgcaaggaaaataaagaggagagctcgagctct
ggatcagacgttgaggttgttggcggacatgatgccaatggtacaaactccaatatggcg
ccgctggaaaccgtcaacaagactcccgcacaatcccagtcatatcgaaacatcatcgct
acgtcaaagggcagccaactagccaatgctaaagcaacaggaactccgaacaccagaagg
aaagccatgatcgtccgtgagaagcgctttacattcgtcctcgctgtggtcattggggtt
ttcatcatctgctggttcccgtttttcttctcctacagcttgcaggccatttgtccagac
atgtgtaaagttccagaaggacttttcaccttcttcttctggatcggctactgcaacagc
gccctgaacccgctcatctacactatcttcaacagagacttcaggaaagccttcaagaag
attctgtgtaagaggtgcaaggactgctccttctga

DBGET integrated database retrieval system