KEGG   Danio rerio (zebrafish): 100331840Help
Entry
100331840         CDS       T01004                                 

Gene name
sphk1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dre  Danio rerio (zebrafish)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Apelin signaling pathway
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100331840 (sphk1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100331840 (sphk1)
   04371 Apelin signaling pathway
    100331840 (sphk1)
   04020 Calcium signaling pathway
    100331840 (sphk1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100331840 (sphk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Unknown
AA seq 493 aa AA seqDB search
MEEPRMHGIFTDADTGRLTYALSLSDSCLTVQRVSSPPSQTPAPEHLDLRDCLGSRAHRG
EREDRDAYYLCVYFYPYRRRWMAWGPVRQRDERRFRLVLNSDDNNDDEQEEEDEEEDAKL
REAERWARAIRNRPGNTRGVLFSEVRRACGVMVLVNPQSGRGQAMAQYNGHVQRMLTEAD
IPHTLVITERQNHARDLVRSTDLSQWDALIILSGDGLLFEVVNGLMERPDWEKAIQTPLG
ILPGGSGNALAASVHHYTRASPVWGEDLLTSCGFLLCKGLVSGLDLISVQLSSGARLFSF
LSLAWGFVADVDIESETFRQIGALRFILGTLVRLASLRIYQGKLAYLPAGETDSVSSTGE
NLLNDHLMAPFGQPVPQNWTLVEEREFVLVLAMFQSHLSEDLMAAPGARADDGIIHLFYL
TAGVSRATLLRLFRAMQSGTHLDCGCAHLVYVRAQAIRLEPLSADGVLTVDGERVHYGPV
QAQVHRAAARIIC
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaccgcgcatgcacgggatattcacggacgcggacaccgggcggctcacatac
gcgctgagtctgtcggacagctgcctcacggtgcagagggtctcgtccccgccatcccaa
acaccggcaccggagcacctggacttgcgcgactgcttggggagccgcgcgcaccggggc
gagcgcgaggaccgggacgcgtattatctgtgcgtttatttctatccgtaccggcgccga
tggatggcttggggtccggtccgacaaagagacgagcggcgatttcggcttgtgctaaat
tcggatgataataatgatgatgagcaggaggaggaggatgaagaagaagacgcgaagctg
cgcgaggcggaacggtgggcgcgcgccatcagaaaccgcccgggaaacacgcgcggtgtg
ttgttctcagaggtccgccgtgcgtgtggcgtgatggtattggtcaatcctcagagtggg
cgtggccaggccatggctcaatacaatgggcacgttcagcggatgctcacagaggcggat
atcccacacacactcgtcatcaccgaacgtcagaatcacgcccgagatctggtgaggagc
acagacctgtcgcagtgggacgccctgatcatcctgtctggagacgggctactctttgag
gtggtgaacgggctgatggagaggccagattgggagaaggccattcagactcccctgggt
attctcccgggaggttctggaaacgctctggctgcttccgtccatcattacacacgtgcg
tctccggtgtggggtgaggatctgctgaccagctgcgggtttctgctgtgtaaaggtctg
gtttcgggtctagacctgatctccgttcagctgtcatccggcgctcgcctgttctccttt
ctctctctggcctggggtttcgtggcggacgtggacatcgagagtgagacattccggcag
atcggcgcgctgcggtttatccttggcacacttgtgcgtctggcatcactgcggatatat
caaggtaaactggcctatttacctgctggagaaacagactctgtgtcttccacaggtgaa
aatctcctgaatgaccacctgatggcgccattcgggcagcctgtaccgcagaattggaca
cttgtagaggagcgcgagtttgttctggtacttgcgatgtttcagtcgcacctgagtgag
gatctgatggcggctccaggagcacgtgctgatgacgggattattcacctattttacttg
actgcaggagtttcgcgtgctacactgctacgcctctttcgcgccatgcagagcgggacg
catttggactgtggatgtgcacatttggtgtacgtgcgcgcacaggccattagattagag
ccgctgagtgcagacggggtgctgacggtggacggagagcgagttcattatggacctgtt
caagctcaggtgcacagagcagcggcgcgcatcatctgctga

DBGET integrated database retrieval system