KEGG   Danio rerio (zebrafish): 100332674Help
Entry
100332674         CDS       T01004                                 

Gene name
usp48, zgc:112364
Definition
ubiquitin specific peptidase 48
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Position
11
AA seq 1047 aa AA seqDB search
MAPRLQLEKAAWRWAEAVRPEDITHEHIELAYRIAVSACKRGACRRNCKGNPNCLVGIGE
QSWLGEIDENTFHNIDDPNSERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRALYRF
QNSRAEGHNTDSDYEPRTICEHLQYLFALLQNSNRRYIDPSGLVKALGLDTGQQQDAQEF
SKLFLSLLEDTLSKQKDPNLQNVIQQQFCGQFSYVTVCNKCGRESPLPSRFYELELNIQG
HKNLTECVTEFLKEEKLDGDNRYYCESCQSKQNATRRIKLQSLPRTLNFQLMRFVFDRQS
GHKKKLNTFISFPEVLDMEPFLEGREEKCTYELSAVLIHRGVSAYSGHYIAHVRDAHTND
WYKFNDEEIEKMEGKKLQLGIEEDIAETAKSQTRKPKCSKGYHCSRNAYMLVYKQQTEEI
NQTESPVDVPAFLQKLVEQDNRKFEEWCSEMSDMRKQSVDKGKAKHEEVKELYELLPAED
GQSYEFVPLEWLKKWLDDSTAIKEIDNSQFLCTHGKLHPDKIGEAKRISLKAADLLFSRY
GGGPRLDRSSLCRDCVTQRCRVIRLKNQLNEDYREVTNLAKSALKSEESGFWIGKASLRS
WRQLALDQLEEDEEETKHNNSKINGEKSSPGTKADGVKGDSEDGDGEEMKNFNEDILCYH
GGLSILENDRRLVSAEVWNKLRMYFPKAPEFTQDHDPCQQCMRLEREGKENEALNRMMAN
EQKSSLLNLFQEKNRPTLQKWPQDTDILYIVPLYFVEEWKKFIRRPAKGNPVSNVGNSIL
LCPHGGFMFTYDSMLQGDAQHIALLWPAEWEVISKMFLVDQVISICRIHDKTQDNGNVQY
QTHPDLCRECREGFIFQQQRDMREYTQATVYVRKVIDKKRMIKESAPEFSVSGSDVEDEK
EEPKLDGEKDPDFSQTEGGAKRQKLNDTVSLPTAVVTTTSKSGIRRSTRHRKLRGEKALI
VSANQTLKDLKIQIMHAFSVAPFDQNLSIDGRCLKDDSATLGSLGVIPESIICLKADEPI
ADYAAMDDVYQVCMPEEGFKGTGLLGH
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcggttgcagctggaaaaagctgcttggcgatgggcagaggcagtcagacca
gaggacatcacacatgaacatatagagctggcttataggatcgcagtgtcggcttgcaaa
agaggggcatgcaggaggaactgtaaaggaaaccctaattgtcttgttggtattggggaa
caatcatggttgggagaaattgatgaaaacaccttccacaacattgatgacccaaattcg
gaaagaagagataagaacacatttgtgggcctgacgaacctcggcgccacgtgttacgtc
aacactttcctccaggtgtggttccacaatctggagctgcgcagagccttatataggttt
cagaattccagagctgaagggcacaacacagattcagattatgaaccacggacgatttgc
gagcatctccagtatctgtttgcactgctacagaacagcaacaggcgatacatcgatcct
tccgggctagtgaaggctcttgggctcgacacaggccaacagcaggatgctcaggaattc
tccaaactcttcctctcacttctcgaagacacactttcaaagcagaaggacccaaatctc
caaaatgtcattcaacagcagttctgtgggcagttctcttatgttacagtatgcaacaaa
tgtggacgtgaatctccattaccatcacgattttatgaactagagctgaatattcaagga
cataaaaacctcacagagtgtgttacagagtttctgaaggaggagaagctggacggtgat
aatcgttactattgcgagagctgtcagagtaaacagaacgccacacgccggatcaagctg
cagagtcttcctcgcacactcaactttcagctcatgcgtttcgtttttgataggcaaagt
gggcataagaagaagctcaacaccttcattagttttccagaagttcttgacatggagccg
tttttggaaggaagagaggagaagtgcacgtatgagctgagcgcggtgttgattcatcgg
ggtgtgagtgcttactccggtcactacatcgcccacgtgagagacgcacacaccaacgac
tggtacaaatttaacgatgaggagatcgagaaaatggagggcaagaaacttcagctgggc
attgaggaagatatcgctgagacggccaaatctcaaaccagaaagccaaaatgtagcaaa
ggctatcactgttcgaggaacgcatacatgttagtgtataaacagcagacagaagagatt
aaccagacggagtctcctgttgatgtaccagcttttctccagaagctggtcgagcaggac
aacaggaagtttgaggagtggtgtagtgagatgtcagacatgcgaaagcagagtgttgac
aaaggcaaagccaaacatgaggaggtgaaggagctctacgaattgttacctgcagaagac
ggccagtcctatgagtttgtgcctctagagtggttgaagaaatggcttgacgactccact
gccataaaggaaatcgacaacagccagttcctgtgcacccatggcaaactgcatcctgac
aagattggggaagccaaaagaatatccttaaaggctgctgatctccttttcagccgctac
ggaggaggacccagactagaccgttcatctctctgtagagactgtgtcactcagcgatgt
cgggtgatcagactgaaaaaccagctaaatgaagattacagagaggtcaccaatcttgcc
aaatccgctttgaaaagtgaagaatcaggattctggattgggaaggcttctttaaggagc
tggagacaattagcattagaccagctagaggaagatgaagaggaaaccaaacacaacaac
agcaaaattaatggagagaaaagcagcccaggaactaaagctgatggggttaaaggagat
agtgaagatggagacggtgaagagatgaagaacttcaatgaagatatcctctgttatcat
gggggtttgagtatcttagagaatgatcgacggctggtttctgccgaggtttggaataaa
ctaaggatgtatttccccaaagcaccagagttcacacaagatcatgatccctgtcagcag
tgcatgaggctggaaagagaagggaaagagaacgaggctttgaacagaatgatggcgaat
gaacagaagagctctcttctcaacctcttccaggagaagaatcggcccacgctacagaaa
tggccacaggacacagacattctgtacattgtgccactttactttgttgaggaatggaag
aaatttattaggaggccagcaaagggtaacccagtgtcaaatgtggggaacagtatcctg
ctctgtcctcacggaggcttcatgttcacatatgactccatgctgcaaggagacgcccaa
catatagctcttctctggcccgctgaatgggaggtgatcagcaaaatgtttctggtggac
caggtcatctccatctgtcggattcatgacaaaacacaagacaacggcaatgtgcaatac
cagactcatccagatctgtgtcgggaatgcagagagggcttcatattccaacagcagagg
gacatgagggagtacacacaggccaccgtgtatgtgcgcaaagtcatcgacaagaaaaga
atgattaaggaatctgcccctgagtttagtgttagtggatcagatgttgaagatgaaaaa
gaggagccaaaattagatggagagaaagatccagacttcagtcagactgagggtggagcc
aaaaggcagaagctgaacgatactgtctctcttcctacggctgtcgtaaccaccacatct
aagtcaggcatcaggaggagcacaaggcacagaaaactgcgtggcgaaaaagccctcatc
gtttctgccaatcagacgctcaaagatctcaagatccagatcatgcacgcgttctcagtg
gctccattcgatcaaaacctttccatagacggacgctgtttaaaagacgactctgccaca
ttgggaagtcttggagtcatacctgagagcatcatttgccttaaggctgatgaacccatt
gctgattatgctgcaatggatgatgtttatcaagtctgtatgcctgaagaaggatttaaa
ggcactgggcttttaggacactga

DBGET integrated database retrieval system