KEGG   Danio rerio (zebrafish): 100333252Help
Entry
100333252         CDS       T01004                                 

Definition
cyclin-dependent kinase 4 inhibitor D-like
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
dre  Danio rerio (zebrafish)
Pathway
FoxO signaling pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100333252
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100333252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 154 aa AA seqDB search
MMVLDGLGCGKSLSAAAAQGDARAVRRILQDHRVEPDALNEFGKTALQVMMMGSSAVAAV
LLDFGADPNVQDRSGVTPAHDAARTGFLETLRVLVDGGASVNVPDHSGALPLHIAVREGH
WDVVEYLAPLTELRWLDGRRVEELLEHLQATGSG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgctggacgggctcggctgcggaaagagtctcagcgcggcggccgctcagggg
gacgcgcgggcggtgcggcggatcctgcaggaccaccgagtagaaccggacgcgctcaat
gagttcgggaaaaccgcgttgcaggtgatgatgatgggctccagtgcagtggctgcggtg
ctgctggatttcggtgcagacccgaatgttcaggaccgcagtggtgtgactccggctcat
gacgccgctcgcaccggtttcctggagacgctgcgggtgctggtggatggcggcgcctcc
gttaacgtgccggaccacagcggggcgctgcccctgcacatcgccgtccgcgagggacac
tgggacgtggtggagtatctggcgcccctgacggagctgcggtggctggacgggcggagg
gtggaggagctgctggagcacctgcaggccactgggtccggatga

DBGET integrated database retrieval system