KEGG   Danio rerio (zebrafish): 100333269Help
Entry
100333269         CDS       T01004                                 

Gene name
aldh1l2
Definition
aldehyde dehydrogenase 1 family, member L2
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
dre  Danio rerio (zebrafish)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:dre00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 923 aa AA seqDB search
MLWTANTIMRKFSSSSVYYQNKLKLALIGQSLFGQEVYTNLRKQGHKVVGVFTVPDKDGK
ADPLAVVAEKDGTPVFKFPRWRVKGKPIPEVVEAYKAVGAELNVMPFCSQFIPMNVIDFP
KHGSIIYHPSILPKHRGASAINWTLIEGDKKAGFSVFWADDGLDTGPILLQKECQVEPND
TVDTLYNRFLFPEGIKAMVEAVQLIANGKAPKIPQSEEGASYEGIQKKSNAKVNMAQPAE
AIHNWIRGHDKVPGAWVVMDGKPVTVYGSSVLSGSVPAGQPIDIEGASQPGLITKSGLLL
FGSDGKALQVKSLQFEDGKMIPASKYFSSEESASLDLTDDEKKMAEEIRAIWKGILSNVA
AIEETTDFFKCGAASMDVVRLVEEVKQKCAGVQLQNEDVYMATTFQSFIQMLVRRLRGED
QEEEMLIDYATKEVNNMTVKMPYQCFINGKFEDADDGKTYNTVNPTDGSVICKVSYASVA
DVDKAVSAAKEAFDNGPWGKMNPRDRGQLLYRLADLMEEHQEELATIETIDSGAVYTLAL
KTHVGMSIQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIVIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELTIKAGIPKGVINIVPGSGGLVGQRMSE
HPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSPLIIFSDCDMDKAVRMGMSSV
YFNKGENCIAAGRLFVEESIHDEYIRRVVEEIKKMKIGDPLDRSTDHGPQNHKAHMDKLV
EYCEIGVKEGATLVYGGRQVDRPGFFMEPTVFTDVEDHMFIAKEESFGPVMVVSKFKDGD
VDGVLSRANDTEFGLASGVFTRDINKAMYVSERLEAGTVFINTYNKTDVAAPFGGFKQSG
FGKDLGEDALHEYLRTKAVTVEY
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgttgtggacagcgaacacgataatgaggaaattctcctcgagctctgtttactaccaa
aataagctgaagctggccctgattggccaaagcttgtttggacaggaagtgtatacaaac
ctccgcaagcagggccataaggtggtcggcgttttcacagttcctgataaggacggcaag
gcggaccccctggcggtggtggcagagaaggacgggacgccggtgtttaagtttccacgc
tggcgagtgaagggtaaacccatcccggaggtggtggaggcgtataaagcagtgggtgca
gaactgaacgtcatgcccttctgctcccagttcatccctatgaatgtgatcgacttcccc
aaacacggctccatcatttaccacccctccatcctgcccaaacacagaggagcctccgcg
attaactggacactaatcgagggcgataagaaggctggattcagtgtattctgggctgat
gatggtttggatactggacccatcctgctgcagaaagagtgtcaagtagagcccaacgac
acagtggacactctttataaccgcttcctgtttccagagggcatcaaggccatggttgaa
gctgtacagctcattgcaaacggaaaagctcccaaaatccctcagtctgaagaaggagcc
agttatgagggaatccaaaagaaatccaatgctaaggtgaatatggctcagccggcagag
gctattcataactggatccgtggacatgataaagttcctggtgcctgggttgtgatggat
ggaaagcctgtaactgtgtacggttcctcagtgttgagcgggtctgtgcctgcaggtcag
cccatagacatagaaggagcgtctcagcctggactcatcaccaaatctggactccttctc
ttcggctctgatggaaaagcgctccaggtgaagagcctacagtttgaggatggaaagatg
attcctgcgtccaaatacttttcatctgaggaatccgccagtttggatcttacagatgat
gagaaaaaaatggcagaggagatcagggcgatctggaaagggattttgagtaatgttgca
gctattgaagaaaccaccgatttctttaagtgtggagccgcttcaatggatgtagtcagg
ttggtggaggaggtgaagcagaaatgcgctggtgttcagctgcagaacgaggacgtttat
atggccaccaccttccagagcttcatccagatgctggtccgacgcctgcgtggagaagac
caggaggaggagatgcttattgattatgccacaaaagaggtcaacaacatgaccgtgaag
atgccctaccagtgcttcatcaacggcaagttcgaagacgcagatgatggaaaaacatac
aacaccgtcaaccccacagatggctcggtgatctgtaaagtgtcttacgcatcagtggca
gatgtggacaaagctgtaagtgctgcaaaagaggctttcgacaatgggccttggggtaag
atgaacccccgtgaccgcggccagctgctgtaccgtttggctgacctgatggaggaacac
caggaagagttggccaccattgagaccatcgactctggtgctgtttacactctggctttg
aaaacacacgtcggcatgtccattcagacattcagatacttcgccggctggtgtgacaag
atccagggctcaacgatacccatcaatcaggccagacccaaccgaaacctcacttttaca
aagaaagagcctttgggtgtgtgtgccattgtaattccctggaactacccgcttatgatg
ttggcatggaagagcgcggcctgtctggcggcgggaaacacactcgtcttaaaacctgct
caggtaactccattaactgcattgaagtttgccgagttgacaatcaaagctggcattcct
aaaggagtcattaacattgtaccaggatcaggtggtctggtcgggcagaggatgtctgag
catcctgatatccgtaagcttggttttacaggctcaacacccattggcaaacagatcatg
aagagctgtgcggtcagtaacctgaagaaagtttcactggagttgggcggtaaatctcct
ctcatcatcttcagcgactgtgacatggataaagcagtgcgaatgggcatgagttctgtg
tacttcaacaaaggagaaaactgtatcgccgcaggccggctgtttgttgaggagtccatt
catgacgagtacatcaggagagtggttgaggaaatcaaaaagatgaagatcggagatcct
ttagatcgctccacagatcatggacctcagaaccacaaggctcacatggacaagctggtg
gagtattgtgagatcggcgtgaaggagggcgcgacactcgtctatggtggacgacaggtg
gacagaccaggatttttcatggagcccacagtcttcacagatgtagaggaccacatgttc
attgccaaagaggagtcatttggccccgtcatggtggtgtccaaattcaaagatggtgat
gtagatggagttttgagcagagccaatgacacagagttcggcctggcttctggcgtcttc
acccgtgacattaacaaagccatgtatgtgagcgagaggctagaggcgggaactgtgttc
atcaacacctacaacaaaactgatgtggcggctccttttggaggcttcaaacagtccggg
tttgggaaagaccttggtgaggacgccctgcacgagtacctgcggactaaagctgtgacg
gtggagtattga

DBGET integrated database retrieval system