KEGG   Danio rerio (zebrafish): 100333639Help
Entry
100333639         CDS       T01004                                 

Definition
voltage-dependent calcium channel subunit alpha-2/delta-2-like
Orthology
K04859  
voltage-dependent calcium channel alpha-2/delta-2
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:dre04010]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:dre04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:dre04261]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 1090 aa AA seqDB search
MARWAHACLLLLLMVILGGSWTAVNALTFPQHYTIMHWARRIEQEIDRVLQHISGAQQLK
GIYLEKKKHFSLVRNNPRDIVEKVATDIERLLAKKRKALERLASEAERLQKEHRWQDGIK
EENIEYYNSKAEMDYDGEDIDSQMSLKLDFVYDPSFKNQVNYSHTAVQIPTDIYKGAPVI
LNELNWTQALERVFIENSRDDPSLLWQAFGSATGVTRYYPAAPWRAPDKIDLYDVRRRPW
YIQGASSPKDMVILVDVSGSVSGLTLKLIKASVTEMLDTLSDDDYVNVARFNEKAEAVVP
CFDHLVQANVRNKKIFKEAVQQMQAKGTTDYKSGFHFAFNQLLNKTNVPRANCNKIIMLF
TDGGEDRAQDIFEQYNWPNKTVRVFTFSVGQHNYDVTPLQWIACSNKGYYFEIRSICAIR
INTQEYLDVLGRPMVLAGRIAKQVQWTNVYQDALGLGLVVTGTMPVFNLTVNGDSQNQLI
LGVMGVDVHLDELKRLTPQYKLGANGYIFAIDPNGYVLMHPNLQPREEDLPEQVTLDFLD
AEVEDSSKQEIRRQMIDGRSGDMTIKTLIKSMDERYIDDVTRMYTWTPINDTDYSLGLVL
PPYSEHYIQADLSDVMLQLQYLQSLLPNSFESAGHVFLAPRDYCRRLHISENNTQFLVDF
LSLMVEISPESEDCDQGLIHNLILDSGILWQLATRVWQNKDLGTYGFLALFASTNGGVTR
VYPNMAAESWDEDPEPLNSNFYRRSLDNKGYIFRAPTRTSMDDLLISENGTVGILVTTAV
EVAFGSKTMKPAVVGVKLDLEAWVDKFKILASNVSDSRQAAHKCGPSRSCEMDCEVNSDD
LLCYLIDDGGFLVMSNQRDHWKKVGLFFGEVDPYLMFALYNNSIYSRHQTFQYQSACEPT
ASSHTGAAHRGFYVPSIADFLSLAWWTSAAAWSILQQFLYGVMYSSWFTTADVWAESADS
KGSSSCVTVYSQFYFTNTTNSFNVLQDCGNCSRLFHAKRIENTNLLFVVAETLPCSSCEI
EKLLPVRTKSQEENPCDVLNSARYRKGPDKCFDYNSEENTSQCGSAHSLHCPLPALLLVQ
LFLIYLILRS
NT seq 3273 nt NT seq  +upstreamnt  +downstreamnt
atggcgagatgggctcacgcgtgtctgctgctgctgctgatggtgattctcggcggatcc
tggaccgcagtgaacgcgctcacatttcctcagcattacacgattatgcactgggctcga
cgcattgaacaggagatcgacagagttttgcagcatattagtggcgctcagcaactgaag
gggatctacttggaaaagaaaaagcacttcagtctggtcagaaacaaccctcgagacatt
gtagagaaagtagcgactgacatcgagagactgcttgccaagaaacgcaaagcgctggag
agactggcgagtgaagcggagcgtcttcagaaagagcatcgctggcaggatggaatcaag
gaggaaaatattgagtattataactctaaagcagagatggattatgacggtgaggacatt
gactctcagatgtccttgaaactggattttgtgtacgacccaagcttcaaaaaccaagtg
aattactcgcacactgccgtccagatccccacagacatctacaaaggcgctccagtgatt
ctgaatgagctgaactggacgcaggcgctagagcgagtcttcattgagaacagcagagat
gatccctcattgctttggcaagcatttggtagtgccaccggtgtcaccagatattaccca
gctgctccctggagagcgccagataagatcgacctttatgatgtacgacgaagaccctgg
tacattcaaggagcgtcgtcacccaaagacatggtcattcttgtagacgtgagcggcagc
gtcagcgggctcacattaaaactgatcaaagcttcggtcacagaaatgctcgacacactc
tccgatgatgattatgtcaacgtggccaggtttaatgagaaggcagaggcagtggtgccc
tgtttcgatcacctggttcaggccaatgtgcgcaataagaagatcttcaaagaggctgtg
cagcagatgcaggccaaagggaccaccgattacaaatccggcttccatttcgccttcaac
cagctcctgaacaagacaaacgttcctcgagccaactgtaataaaatcatcatgttgttc
actgacggcggagaggaccgagcgcaggacatcttcgagcagtacaactggcctaataag
acggtccgcgtgttcacgttctcggtggggcagcacaattacgatgtcactccgctgcag
tggattgcatgctctaataagggatactattttgagatccgctccatctgtgctataagg
attaacacccaggaatatctggatgtattgggtcgcccgatggttctggcaggcagaatc
gccaaacaagtacagtggacaaacgtctatcaggacgccctgggtctgggtctggtggtg
acagggacaatgccggtgttcaaccttactgtgaacggggactctcagaatcagctgatt
ttaggtgtgatgggggtcgacgttcatctggacgagctgaagagactcacaccacagtac
aagctcggagccaatggatacatcttcgccattgacccgaacggatacgtgctgatgcat
ccaaacctgcagcctcgagaagaggatttaccggagcaggtgactctggactttctggat
gcagaagtggaagacagcagcaaacaggagattcgccggcagatgattgacggccgatcg
ggagatatgaccattaaaactctaattaaatcaatggacgagcgctacattgacgacgtc
acccggatgtacacctggacgcccatcaacgacacagactacagtctaggtttggtactg
cctccgtacagtgaacattacatccaagctgatctgagtgatgtcatgctccagctgcag
tatttacagtctctgctgcccaactctttcgagtctgccggtcatgtgtttctcgctccc
agagattattgcaggcgcctgcacatctctgaaaacaacacacagttcctggtggacttc
ctgtctctgatggtggagatctcaccggagtctgaagactgtgatcagggtctcattcat
aacctgatcttggactccgggatcctctggcagctcgccacacgcgtttggcagaataaa
gacctgggcacgtatggctttctggctctgtttgcgtccaccaatggaggcgtcacacgt
gtttaccccaacatggcggctgaatcatgggatgaagatcctgaaccactaaactcaaac
ttctaccggcgcagtctggataacaaaggctacatcttcagagcgccgacacgaacctcg
atggatgatctgctgatctcagagaatggcactgtggggattctggttaccaccgccgta
gaggttgcatttgggagcaaaaccatgaagcctgcagtggtcggcgttaagctggatttg
gaggcttgggtcgacaagttcaagatcttggccagcaacgtgtccgacagcagacaggcc
gcacataagtgcggcccgtccagatcctgtgagatggactgtgaagtgaacagcgatgat
ttgctgtgctatctgatcgatgatggcggtttcctggtgatgtccaatcagagagatcac
tggaagaaggttgggctgtttttcggtgaggtcgacccgtacctgatgttcgccctctac
aacaactcaatctactcccgtcatcagaccttccagtatcagtcggcctgcgaacccaca
gccagcagccacacaggagccgcacacagaggattctacgtgccctccatagcggacttt
ctcagcctagcctggtggacgtctgcagccgcgtggtctattttgcagcagttcttgtat
ggagtcatgtacagcagctggttcaccacagcagacgtctgggctgagagtgcagacagt
aaagggagcagcagctgtgtgacggtttacagccagttctacttcaccaacaccaccaac
tccttcaacgtcctgcaggactgcggcaactgctccaggttgttccatgccaagcgtata
gaaaacacaaaccttttgtttgtggtggctgagacactgccctgcagctcctgcgagatc
gagaaactcctgcctgtcagaaccaagtctcaagaagaaaacccatgtgatgtcttaaac
tcggcccgctataggaaaggacctgacaaatgcttcgactacaactcagaggagaacaca
tcacagtgtggcagcgctcactctttacactgtccgctgccagctctgctcttggttcag
ttatttttgatttacctcattctacgatcgtaa

DBGET integrated database retrieval system