KEGG   Danio rerio (zebrafish): 100334535Help
Entry
100334535         CDS       T01004                                 

Gene name
usp18
Definition
ubiquitin specific peptidase 18
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100334535 (usp18)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100334535 (usp18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 337 aa AA seqDB search
MGDYWSKMAYHRRYIRSSSWSSNRGYEVRGLFNDGLSCCVNALLQSFSATTELLDILNKW
NPSDGIEQSNIPLQLRNTLLSVRDPSHSAPHKGFLDCLYRHAICRYTQQDADEIFHMILN
LSLKQMPDHELAQEIRSLYTIEVETQVTCMDCTFIHRLPNSYFSLPLVIHEGENTLESCI
KSFFKKQKLEVSEKFFCDRCEKKQPCAYEQKLVSLPQILCVHLKRFRNEHGLIKKLDSKV
TFPETLKISVFAAGQSENAASDSPQADYSLFAVIVHIGSAMFGHYTAFIRQTQDQMWYYA
NDSRVNQATWKDVQDTYKGRETAYLLLYRKKSLDSSG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgggggactactggagtaaaatggcttatcatcgacggtacatccgctcttcatcatgg
agctctaacaggggttatgaagtgagaggccttttcaatgacggtctatcctgttgtgtt
aatgctttgcttcagtccttttctgccacaactgaactgctggacatactgaacaaatgg
aatccttcagatggaattgaacagagtaacatcccattgcagttgaggaacacactgctc
tccgtgagggacccttcacattcagctccacataaaggctttctggactgcctctatcgt
cacgccatttgcagatacactcaacaagatgccgatgaaatattccacatgatcctcaat
ctcagtctgaagcagatgcctgatcatgagctggctcaggaaatccgcagtctttatacg
attgaggtggaaacacaggtgacatgtatggattgcacatttattcacagattgcccaac
tcatatttcagccttcctctggtgattcatgaaggggaaaacaccctggagagctgcatc
aaatctttcttcaagaaacaaaagctggaggtcagcgagaagtttttctgtgaccgctgt
gaaaagaagcaaccatgtgcttatgagcagaaacttgtctcattgcctcagattctgtgt
gtccacttgaaaagattcagaaatgaacatggattgattaagaagctcgacagcaaagtc
accttccctgaaacactgaagataagcgtgtttgctgcaggacaatcagaaaatgctgca
tctgattctcctcaggctgattacagtctgtttgcagtaatagttcatataggatctgca
atgtttggtcattataccgctttcatcagacaaacgcaggaccagatgtggtattatgcc
aatgacagccgcgtgaatcaagctacatggaaggatgtgcaggacacatataaaggaaga
gaaacagcctacttgcttctgtacagaaagaagagtttggattcatctggataa

DBGET integrated database retrieval system