KEGG   Danio rerio (zebrafish): 100334535Help
Entry
100334535         CDS       T01004                                 

Definition
ubl carboxyl-terminal hydrolase 18-like
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 336 aa AA seqDB search
MGDYWSKMAYHRRYIRSSSWSSNRGYVRGLFNDGLSCCVNALLQSFSATTELLDILNKWN
PSDGIEQSNIPLQLRNTLLSVRDPSHSAPHKGFLDCLYRHAICRYTQQDADEIFHMILNL
SLKQMPDHELAQEIRSLYTIEVETQVTCMDCTFIHRLPNSYFSLPLVIHEGENTLESCIK
SFFKKQKLEVSEKFFCDRCEKKQPCAYEQKLVSLPQILCVHLKRFRNEHGLIKKLDSKVT
FPETLKISVFAAGQSENAASDSPQADYSLFAVIVHIGSAMFGHYTAFIRQTQDQMWYYAN
DSRVNQATWKDVQDTYKGRETAYLLLYRKKSLDSSG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgggggactactggagtaaaatggcttatcatcgacggtacatccgctcttcatcatgg
agctctaacaggggttatgtgagaggccttttcaatgacggtctatcctgttgtgttaat
gctttgcttcagtccttttctgccacaactgaactgctggacatactgaacaaatggaat
ccttcagatggaattgaacagagtaacatcccattgcagttgaggaacacactgctctcc
gtgagggacccttcacattcagctccacataaaggctttctggactgcctctatcgtcac
gccatttgcagatacactcaacaagatgccgatgaaatattccacatgatcctcaatctc
agtctgaagcagatgcctgatcatgagctggctcaggaaatccgcagtctttatacgatt
gaggtggaaacacaggtgacatgtatggattgcacatttattcacagattgcccaactca
tatttcagccttcctctggtgattcatgaaggggaaaacaccctggagagctgcatcaaa
tctttcttcaagaaacaaaagctggaggtcagcgagaagtttttctgtgaccgctgtgaa
aagaagcaaccatgtgcttatgagcagaaacttgtctcattgcctcagattctgtgtgtc
cacttgaaaagattcagaaatgaacatggattgattaagaagctcgacagcaaagtcacc
ttccctgaaacactgaagataagcgtgtttgctgcaggacaatcagaaaatgctgcatct
gattctcctcaggctgattacagtctgtttgcagtaatagttcatataggatctgcaatg
tttggtcattataccgctttcatcagacaaacgcaggaccagatgtggtattatgccaat
gacagccgcgtgaatcaagctacatggaaggatgtgcaggacacatataaaggaagagaa
acagcctacttgcttctgtacagaaagaagagtttggattcatctggataa

DBGET integrated database retrieval system