KEGG   Danio rerio (zebrafish): 100334559Help
Entry
100334559         CDS       T01004                                 

Definition
histone H2B 1/2-like
Orthology
K11252  
histone H2B
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 124 aa AA seqDB search
MPEPAKAAPKKGSKKAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacccgcaaaagctgcgcccaagaagggctccaagaaagccgtgacgaagacc
gccggtaaaggaggaaagaagcgcaagaggaccaggaaggagagctacgccatctacgtg
tacaaagtcctgaagcaggtccatcctgacaccggcatctcctccaaggccatgggcatc
atgaactcgttcgtcaacgacatcttcgagcgcatcgccggtgaggcttctcgtctcgcc
cactacaacaagcgctccaccatcacctccagagagatccagaccgccgtgcggctgctg
ctgcccggagagctggccaaacacgccgtgtccgagggcaccaaggccgtcaccaaatac
accagctccaagtag

DBGET integrated database retrieval system