KEGG   Danio rerio (zebrafish): 100334807Help
Entry
100334807         CDS       T01004                                 

Definition
histone H2B 1/2-like
Orthology
K11252  
histone H2B
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
25
AA seq 124 aa AA seqDB search
MPEPAKTAPKKGSKKAVTKTAGKSGKKRRRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccagcgaagaccgcgcccaagaagggctccaagaaagccgtcaccaagacc
gctggcaaaagcggcaagaaacgcagaagaaccaggaaggagagctatgctatctacgtc
tataaggtgttgaagcaggtccatcccgacactgggatctcttctaaggcgatgggcatc
atgaactcgttcgtcaacgacattttcgagcgcatcgccggtgaggcgtctcgtctcgct
cactacaacaagcgctccaccatcacttccagagagatccagaccgccgtgcgtctgctg
ctgcctggtgaactggctaaacacgccgtgtctgagggcacaaaggccgtcaccaagtac
accagctccaagtaa

DBGET integrated database retrieval system