KEGG   Danio rerio (zebrafish): 100334807Help
Entry
100334807         CDS       T01004                                 

Definition
(RefSeq) si:ch73-36p18.3
  KO
K11252  
histone H2B
Organism
dre  Danio rerio (zebrafish)
Brite
Chromosome [BR:dre03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100334807
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100334807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
25
AA seq 124 aa AA seqDB search
MPEPAKTAPKKGSKKAVTKTAGKSGKKRRRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccagcgaagaccgcgcccaagaagggctccaagaaagccgtcaccaagacc
gctggcaaaagcggcaagaaacgcagaagaaccaggaaggagagctatgctatctacgtc
tataaggtgttgaagcaggtccatcccgacactgggatctcttctaaggcgatgggcatc
atgaactcgttcgtcaacgacattttcgagcgcatcgccggtgaggcgtctcgtctcgct
cactacaacaagcgctccaccatcacttccagagagatccagaccgccgtgcgtctgctg
ctgcctggtgaactggctaaacacgccgtgtctgagggcacaaaggccgtcaccaagtac
accagctccaagtaa

DBGET integrated database retrieval system