KEGG   Danio rerio (zebrafish): 100334869Help
Entry
100334869         CDS       T01004                                 

Definition
(RefSeq) histone H2B 1/2
  KO
K11252  histone H2B
Organism
dre  Danio rerio (zebrafish)
Brite
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100334869
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100334869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 100334869
NCBI-ProteinID: XP_017212661
Ensembl: ENSDARG00000086751
UniProt: Q5BJA5 A7MCA7
Position
7
AA seq 124 aa AA seqDB search
MPEPAKAAPKKGSKKAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacccgctaaagctgcgcccaaaaaaggctccaagaaagccgtgacgaagacc
gccggtaaagggggaaagaagcgcaagaggaccaggaaggagagctacgccatctacgtg
tacaaagtgctgaagcaggtccatcctgacaccggcatctcctccaaggccatgggcatc
atgaactcgttcgtcaacgacatcttcgagcgcatcgccggtgaggcttctcgtctcgcc
cactacaacaagcgctccaccatcacctccagagagatccagaccgccgtgcggctgctg
ctgcccggagagctggccaaacacgccgtgtccgagggcactaaggccgtcactaaatac
accagctccaagtag

DBGET integrated database retrieval system