KEGG   Danio rerio (zebrafish): 100499533Help
Entry
100499533         CDS       T01004                                 

Gene name
itgb6, im:7165241
Definition
integrin, beta 6
Orthology
K06589  
integrin beta 6
Organism
dre  Danio rerio (zebrafish)
Pathway
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100499533 (itgb6)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100499533 (itgb6)
  Cellular commiunity
   04510 Focal adhesion
    100499533 (itgb6)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100499533 (itgb6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
11
AA seq 782 aa AA seqDB search
MGIVSLCLVLYFWLDSVGGTCSQISALSCDDCLQLGPQCAWCTLQNFTDFFPVDERCDTP
EALLQKGCSGEFVEFPVTNVKVLKDQGLGKNSGHTNVSYIAPQKMRLQLRPGSQLTFQIQ
VQQPKDHPVDIYYLMDLSASMFDDLKKIKDLGSTLSKEMANLTSKFRLGFGSFVEKPVLP
FIKITREELANPCRSFDLECLPTFGYRHLLSLTSSTDRFNEIISKQQISANIDIPEGGFD
AIMQAAVCGDRIGWRNDSMKLLVFVSDADSHFGMDSKMSGIVVPNDGECHLDGNNEYSMT
AHLEYPTLGQLVDKLVENNILLIFAVTKDQKENYENYASLIPGATVGVLASDSRNILELI
MTSYKELRSEIDLEVLGNTEGLQMSFTALCQDGTITPGHKNCTNVKAGDVVSFNVTVEIK
GCLGGPRRFSLRPVGFQDALEIELESQCVCSCHQTPETNSSFCSRGRGALECGECVCDPG
FVGPKCECTESQDQVSDCRANEGAEVCSGQGECFCGQCVCLPSSFGRVYGPYCECDNFSC
LRFRGELCGGHGECDCGECVCDSGWMGEFCNCSTSNRSCVSSDGSVCSGRGRCVCGKCEC
SVPGASGKHCERCPTCGDICSIHRSCAECFLKAKEPSDECAVKCSSLHTAVSNSTDFEES
RAAPCTLQSEESCLLSFSLVASDHGSIIYNPKLYDCSEPPNAPLIALGVCMSVLIIGIAL
LVIWKFLVSVHDRKEVAKFEAEKAKAKWQSGTNPLFRSSTSTFKNVTYKSTGQQKSDVSL
GR
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggggattgtttcactctgccttgtcctttacttctggctcgactctgtcggagggacg
tgttctcagatcagtgctctctcttgtgacgattgtctgcagctcgggccacagtgcgct
tggtgcacactacagaacttcacagattttttcccagttgatgagagatgcgacacaccg
gaggctcttctccagaagggatgctctggcgaatttgtggaatttcccgtcacgaacgtc
aaagtactgaaggatcaaggtttaggaaagaactcaggccacaccaatgtgtcatacatc
gcaccgcagaagatgcgcctccagcttagaccaggaagtcagctgacttttcagattcaa
gtgcagcaaccgaaggaccatccagtggacatttattacctgatggacttgtcggcgtcc
atgtttgatgatctaaaaaagatcaaagacttgggttcgacgctctcaaaagagatggct
aatcttaccagtaaattcagactaggatttggctcatttgtggagaaacccgttctgccg
ttcatcaagataacccgcgaggagctggccaatccctgcaggagttttgatttagaatgt
cttcccacatttggatacagacacctcctgtcgttaactagcagcactgacaggtttaat
gagatcatctccaagcagcagatatcggcgaacattgacattcccgagggcggctttgat
gccatcatgcaggccgcagtctgtggggataggattggctggcgaaacgactccatgaag
ctgctggtgttcgtgagcgatgctgattctcattttgggatggacagtaaaatgtccggc
atcgttgtgccaaatgatggagaatgtcacctggacggcaataatgagtattctatgact
gcccacctggagtatccaactttaggccagcttgtcgacaaactggttgaaaacaatatt
ctcctcatattcgctgtgactaaagatcagaaggagaactacgagaattatgcgagtctg
attcctggtgctactgtgggggttttggcatccgattccaggaacattctggagctcatc
atgacctcatataaggaactgagatcggagattgacctggaggttttgggtaacactgag
ggtctgcagatgtccttcacagctctctgtcaggacgggaccatcacacccggacataaa
aactgcaccaatgtcaaagccggtgatgtggtatcttttaacgttacggtggagataaaa
ggctgtcttggtggtcctcggcggttttctttgcggcctgtgggtttccaagatgccctg
gagatcgagctggagtcgcagtgtgtgtgtagctgccatcagacacccgaaaccaacagc
agcttctgcagccgaggccgcggggcgctggagtgtggagagtgtgtgtgtgatccgggt
ttcgtgggaccgaagtgtgagtgtacagagagccaggatcaagtcagtgactgcagggct
aatgaaggtgcagaggtttgcagcgggcagggcgagtgtttctgtggacagtgcgtgtgt
ctgccgtccagtttcggccgtgtgtacgggccgtactgtgaatgtgacaacttctcctgc
ctgcgcttcagaggagagctctgcggaggtcatggggagtgtgactgtggtgagtgtgtg
tgtgacagcggctggatgggtgagttctgtaactgcagcaccagtaaccggtcgtgtgtg
tcctcggatgggtcagtctgcagtggacggggcaggtgtgtgtgtgggaagtgtgaatgc
agtgttcctggagcctcgggcaaacactgtgaaagatgcccaacgtgtggagacatctgc
agcatacacaggtcttgtgctgagtgtttcctaaaagctaaagagccgtcagatgagtgt
gctgtaaagtgcagctctctacacaccgccgtcagcaattcaacagattttgaggagagt
cgggcagcaccatgcaccttacaaagcgaggagagttgcctgctgtctttcagcttggta
gccagcgatcacggcagcatcatttacaaccccaagctttacgactgctcagaaccacca
aacgcaccactgatcgctctgggtgtgtgcatgtctgtcctcatcatcggcattgcactc
cttgtgatctggaagtttcttgtttctgttcatgaccggaaagaggttgccaagtttgaa
gcagaaaaggccaaagccaaatggcagtcgggcacgaatcctcttttcaggagctcgacg
tcaacgtttaaaaatgtgacctacaaaagcacagggcagcagaagagtgatgtttcttta
ggccgctga

DBGET integrated database retrieval system