KEGG   Danio rerio (zebrafish): 100526683Help
Entry
100526683         CDS       T01004                                 

Gene name
aldh1l1
Definition
aldehyde dehydrogenase 1 family, member L1 (EC:1.5.1.6)
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
dre  Danio rerio (zebrafish)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    100526683 (aldh1l1)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     100526683 (aldh1l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
6
AA seq 903 aa AA seqDB search
MKIAVIGQSLFGQEVYKELKNEGHMIVGVFTIPDKDGKVDPLAIEAEKDGVPVFKFPRWR
LKGKAITEVVDQYKAVGAELNVLPFCSQFIPMEVIDHPKHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFTVFWADDGLDTGPILLQRECDVEPNDNVNSIYKRFLFPEGVKGMVEAV
RLIATGKAPRIKQPEEGATYECIQKKENSKIDWNQPAEAIHNWIRGNDRVPGAWAEIDGK
SVSFYGSTLLENDHFSSNGQPLEIPGASRAALVTKNGLVLFGNDGKMLLVKNLQFEDGKM
IPGSQYFKAGVTSTVELSEDENRFAEQMRVVWKSILTNVEKIEDTTDFFKSGAASMDVVR
LVEEVKLRAAQLQLQNEDVYMATSFQEFIQMCVRKLRGEDEEEEFNVDYVEKKLNNMTIH
IPHQLFINGEFVDAEGGKTYKSINPTDGQAICDVSLAQISDVEKAVAAAKEAFEEGEWGK
MNPRDRGKLLYKLADLMEQHQEELATIESIDSGAVYTLALKTHIGMSIQTFRYFAGWCDK
IQGCTIPINQARPNRNLTFTKKEPIGVCGIVIPWNYPLMMLAWKTAACLAAGNTVVLKPA
QVTPLTALKFAELTALAKFPKGVVNILPGSGSLVGQRLSDHPDVRKLGFTGSTEIGKHIM
KSCAVSNVKKVSLELGGKSPLIIFNDCDLDKAVRMGMSSVFFNKGENCIAAGRLFIEESI
HDIFLERVVSEIRKMKIGDPLDRSTDHGPQNHKAHLDKLVEYCEKGVKEGAKLVCGGKQV
ERPGFFFEPTVFTDVQDHMYIAVEESFGPVMIISKFSNGEVDKVLQRANATEFGLASGVF
TRDISKALYVSEKLQAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGQEALNEYLKTKCVT
VEY
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgcagtgattggccagagtctctttggacaggaggtatacaaagaattgaag
aatgaaggccacatgattgttggtgtattcacaatccctgacaaagatggaaaagtagac
ccacttgcgattgaggcagagaaggatggtgtgccagtgtttaagtttccccgctggagg
ctgaagggaaaggccattacagaagtggtagaccagtacaaagcagttggtgcggaactg
aatgttctacctttctgctctcagttcatcccaatggaagtgatagatcacccaaaacat
ggttccatcatttaccatccttccctgctgcccagacacagaggtgcctctgccattaac
tggaccctcattcatggtgataagaagggagggtttactgttttctgggcagatgatgga
ctggacacaggaccaattcttttgcaaagagaatgtgatgttgagccaaatgacaacgta
aacagcatctacaagcgcttcctgtttccagagggagtcaagggcatggtagaggcagtc
aggttgattgcaacagggaaagctccaagaatcaagcaacccgaagaaggagccacatat
gagtgtattcagaagaaagaaaattcaaagattgactggaatcaaccagcagaagccatt
cataactggatcagaggaaatgacagagtacctggagcctgggcagagatagatggcaaa
agtgtgtcattttatggatccactctgttggaaaatgatcatttttcaagtaatggtcaa
cctttggaaatccctggagcaagtcgagctgccctagttaccaaaaatggccttgttctc
tttgggaatgatggaaagatgttgcttgtgaaaaacctgcagtttgaggatgggaagatg
attcctggctcccaatattttaaagctggtgtcacgtctacagtggagctctctgaggat
gaaaatcgattcgctgagcagatgagggtggtgtggaagagtattttaactaacgtagag
aagattgaagacactactgacttctttaagtctggcgctgcatcaatggacgtagtcagg
ctggtggaagaggtcaagttgagggcagcacagttgcagttgcagaatgaggacgtttac
atggcgacaagctttcaagagttcattcaaatgtgtgtgaggaagttaagaggagaggat
gaggaagaagagttcaacgtagactatgtagaaaagaaactgaacaatatgacaattcac
atcccccaccagctttttataaatggggaatttgtggatgcggaaggaggaaaaacctat
aagagcattaaccctactgacggacaagcaatctgtgacgtgtctttagctcagatctct
gatgtggaaaaagcagtcgctgcagctaaagaagcttttgaggaaggagagtgggggaag
atgaaccccagagacagaggcaagctgctttacaaactggcagatctgatggagcagcat
caagaagagttggctaccattgaaagcatagactcgggagcagtctatacccttgccctc
aaaacacacattggcatgtctatccagacattcagatactttgctggctggtgtgacaag
attcagggctgcactattcccataaaccaggctcgacctaatcgaaaccttacctttacc
aagaaagagcccattggtgtgtgcggcattgtaattccatggaattatccactgatgatg
ctggcttggaagactgcggcctgcctggctgctggaaacactgtagttcttaaacctgcc
caggtcacacctttgactgctctcaaatttgctgaattaactgctctggcaaaatttcca
aaaggagtggtgaacatactacctggatcagggtctttggttggtcagcgactttctgat
caccctgatgtccgaaaactgggcttcactggctctactgagattggcaaacatatcatg
aaaagttgcgcagtcagcaatgtgaaaaaggtttctcttgagctcggagggaaatctcct
ctcatcatctttaatgactgtgatctggacaaggcagtcagaatgggcatgagctctgtg
ttcttcaataagggggagaactgcattgcagcagggagactattcattgaggagtccatc
catgacatttttctggaaagagtggttagcgaaataaggaagatgaagattggtgatcct
ctggaccgttccacagaccacggtccccaaaaccacaaagctcatctggacaaactggtg
gaatactgcgaaaagggggtcaaagaaggagcaaaattagtgtgtggaggaaaacaagtg
gagcgtccaggtttcttctttgaaccaactgttttcactgatgtgcaggatcacatgtat
atcgctgtcgaggagtcttttgggcctgtcatgatcatctccaaattcagcaatggagaa
gttgacaaggtgctgcagagggctaatgctacagaatttggcttagcatcaggtgtgttt
acacgtgacattagtaaggctctctatgtgagtgaaaagcttcaggctggcactgtgttc
atcaacacgtacaacaagacggatgtggcagctccttttggtggcttcaaacaatctggc
tttggcaaagatttgggtcaagaagctctgaatgagtatctgaagactaaatgtgtcaca
gtggaatactaa

DBGET integrated database retrieval system