KEGG   Danio rerio (zebrafish): 100535100Help
Entry
100535100         CDS       T01004                                 

Definition
Na(+)/H(+) exchange regulatory cofactor NHE-RF2-like
Orthology
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 355 aa AA seqDB search
MASDLKPRLCVMKKGENGYGFHLHGEKGKTGQYIRKVERASPAEASGLRAGDRVVEVNGE
NVERETHHQVVQRIKAVEHETRLLVVDRETDEYFRSLRLTCTEEMAIRTSPTATTPLPSP
STSKQGNGSVSKRSEISKPIRKPPSRALKKDVQPSSESSTRDPSELVPRLCFLVRSDTGY
GFNLHSEKSKPGQYIRALDPGSPADRAGLKPQDRLIEVNGVNIESMRHAEVVAFIKNGGK
ETRLLVVDPDTDEHFKKMNITPTSIHVKDFDESITNGSSSPHVNGTSSRSTHSDGSSQDN
NVQYSSSHLLDPFEETGLNLSPTAAEAKEKAHAKRARKRAPQMDWNKKHEIFSNF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgatttgaagcctcgcttgtgcgtaatgaagaaaggagagaacggctatggg
tttcatctgcacggagagaaaggaaaaaccggacagtacatacggaaagtggaacgcgcg
tccccggcggaggcgtcgggactgcgcgcgggtgaccgtgtggtggaggtgaacggcgag
aacgtggagagagagacacaccatcaggtggtgcagcggattaaagctgtggaacatgag
accagactgctggtggttgacagagagactgatgagtatttccgcagtcttcgtctcacc
tgcactgaggaaatggccatccgcacgagccctacagccacgacccctttaccctcaccc
tccaccagtaaacagggcaatggatcagtgtccaaacggagcgagatttccaaacccatc
aggaaacctccgtcacgagctctcaagaaggatgttcagccctcatcagaatcctcgacg
cgggatccatctgagcttgtcccgaggctctgtttcctggttcgctctgacacgggttac
ggcttcaatctgcacagcgagaagtctaaaccgggtcagtacattcgggcgctggaccct
ggatcgcccgctgatcgcgccggactcaaaccacaggacagactcatagaggtgaatgga
gtgaacattgaaagcatgaggcacgctgaggttgtggccttcatcaagaacggcgggaaa
gaaacccgtttgctggtggtagatccagatacagacgagcatttcaagaagatgaacatc
actcctaccagcatccacgtcaaagattttgatgagtctataacgaacggctcctccagc
cctcatgtaaacgggacgtcctcgcgatccacacattcagatggcagcagtcaggacaac
aacgtacagtactcgagcagtcacctcctggacccgtttgaagaaacaggtctgaatctg
agccccacggcggccgaggctaaagagaaagcccacgccaaacgcgccagaaagagagcg
ccgcagatggactggaacaagaaacatgagatcttcagcaatttctga

DBGET integrated database retrieval system