KEGG   Danio rerio (zebrafish): 100535196Help
Entry
100535196         CDS       T01004                                 

Gene name
cacna2d3
Definition
calcium channel, voltage-dependent, alpha 2/delta subunit 3
Orthology
K04860  
voltage-dependent calcium channel alpha-2/delta-3
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100535196 (cacna2d3)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    100535196 (cacna2d3)
   04261 Adrenergic signaling in cardiomyocytes
    100535196 (cacna2d3)
Ion channels [BR:dre04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   100535196 (cacna2d3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 1080 aa AA seqDB search
MKCVFCRLFVLLLWIINDSGICASHQGIPLSVVKLWASAFGGEIKSIAAKYSGSQLLQKK
YKEFERSVRVEEIDGIKLVKKLAAKMEQRFHKKAEAIKRLVEAAEEAHLNHEEDPDLQYE
YFNAVLINELDEEGRSVELGGEFILQPNEHFNNLSVNLSLSVVQVPTNMYNKDSDIVNGV
YWSEALNTVFVDNFKRDPSLLWQYFGSAQGFFRQYPGMKWTPDEHGVLEFDCRNRKWYIQ
AATSPKDVVILVDVSGSMKGLRLTIARQTVSSILDTLGDDDFFNVIAYNEDLHYVEPCLN
GTLVQADITNKDHFRQRLDKLLAKGIGMLDVALTEAFELLSNFNQTGRGSECSQAIMLVT
DGAVETYDAVFAVYNWPDRKVRVFPYLIGRESAFADNLKWMACANKGYFTQISTLADVQE
NVMKYLHVLSRPKVIDREHDMVWTEAYIDNTRSQAQKLEDAQGPVLMTTVAMPVFSTKNE
TRNKGILLGVVGTDVPVSEILKAIPKYKLGIHGYAFAITNNGYILTHPDLQPLYEEGKKR
RKSSYSSADLSEVEWEDKEDELRNAMVNRQTGSFSMKVKKTVDKGKRVLVLHNDYYYTDI
KGTPFSLGVALSGGHGKYVFRGNISVEEGLHDLEHPDVALADEWTYCNTEEHPDHPVLSQ
IEAIKLYFNGEEHLKCDQELVQEVLFDAVVTAPLEAYWTSLALNKSENSDKGVEISFLAT
RTGLSRINLFVTPDQLSNQGLLTGEDKEVQFSADHFPLWYRRAAEQVPGTFVYSLPYDAA
SDNKSVVLASSAIHLLDERESPIAAAVGIQMKLEFFQRKFWTASRQCAALDGKCSISCDN
DDISCYLIDNNGFIIVAEDQSLTGVFFGEPEGAVMGKLVSMGSFKRVNLYDYRAICRVYA
QTSDTAHTLLHPYFALFAAIRWLLTEFVIFLVEFNLYSWWHSDLTITAHRGGRTLLVPCD
TEYPAFVSERTIKETVGNIDCESCVKSFVIQQIPSSNLFMVVIDNTCDCSDFGPVTMEPV
EIMYNESLKCERLKFQKDRRRPDTCHPFHHEENSMECGGSVSLSPSSPALLVLIISIFSR
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtgttttctgtcggctgtttgtcctcctcctgtggattattaatgattcagga
atatgtgcgtctcatcaagggatccccctgtcagttgtgaaactttgggcttcggcgttt
ggcggagagataaaatccatcgcagctaaatattcaggctctcagctgctgcaaaagaag
tataaggagtttgagcggtcggtgagggtggaggagatcgatggcatcaaactggtgaag
aaactcgctgccaaaatggagcagaggtttcacaagaaagctgaagccataaagcgtttg
gtggaagcagcagaagaagcacacctgaaccacgaggaggatcctgacctacagtacgag
tattttaatgcagtgttgatcaatgagttggacgaggagggccgcagcgtggagctgggt
ggagaattcatccttcagccgaacgaacatttcaataatctgtcagtaaacctcagcctc
agtgtcgtccaggtgccaactaacatgtacaacaaagactcagacatcgtgaacggggtt
tactggtcagaggctctcaacacagtgtttgtggacaactttaaaagagacccttctctc
ctatggcagtattttggcagcgctcaaggtttcttcagacagtatccaggaatgaagtgg
acgcctgatgaacacggagttctagagtttgactgtcgaaatcggaaatggtatatccag
gccgctacgtctcctaaagatgtggtgatattggtggatgtgagcggcagtatgaagggt
ttacggctcaccatcgctagacagaccgtctcctctatactggacacactcggagacgac
gacttcttcaacgttattgcttacaacgaggatctgcattacgtggagccgtgtctgaac
ggaacattagttcaggctgacattaccaacaaagatcatttccgccagcgtctcgataag
ctcctcgctaaagggatcggcatgctggacgtggctctgacagaggcctttgagctgctc
agcaattttaatcagacaggcagaggcagtgagtgcagtcaggctataatgctggtgaca
gacggcgcagtggagacatatgatgctgtgttcgccgtctacaactggcctgacaggaag
gtgcgtgttttcccttacctgattggtcgagagtctgccttcgctgataacctgaagtgg
atggcctgcgctaataaaggttacttcacccagatctccacgctggcggacgtacaggag
aacgtgatgaagtatctgcatgttctcagtcggccgaaagtcatcgatcgagagcatgac
atggtgtggactgaagcctacatcgacaacactcgttcgcaggctcagaagctggaagac
gctcagggtccagtgctcatgactaccgtggccatgcctgtgttcagcaccaaaaacgag
accaggaataaagggattcttcttggagtggtcggcacagatgtaccagtgtcagaaatc
ctgaaggccatccccaaatacaagctgggaatccatgggtatgcctttgccatcaccaac
aacggatacatcctcacccatccggacctgcagccgctgtatgaagaaggaaaaaagagg
agaaagtccagttacagcagcgcagatctgtccgaggtggagtgggaggacaaggaggac
gagctgcgtaacgctatggtgaacagacagacgggaagcttctctatgaaagtcaagaaa
actgtggataaagggaagcgggtgcttgttcttcacaatgattactactacacagacatt
aaaggaacgcccttcagcttaggagtggctctgtctggaggtcacggcaaatatgtcttc
agaggaaatatctctgttgaagaagggctgcatgatttggagcatccagacgttgcatta
gcagatgaatggacatactgtaacacagaggaacatccagaccatcccgtgctctctcag
attgaagccattaagctgtatttcaatggagaagagcatctgaagtgtgatcaggagctg
gtgcaggaggtgttgtttgatgcggtggtcacggcaccactggaggcgtactggaccagc
ctcgctctcaataaatccgaaaactctgataaaggtgtggagatctctttcctcgccact
cgaactggattatcacgcatcaacctttttgtgacgccagatcaactgagcaatcaaggc
ctcctgacaggagaggataaagaggtgcagttcagcgctgatcatttccctctgtggtac
agaagagctgctgaacaggtgcccggcacatttgtctacagccttccgtatgacgcagcc
tctgacaataagagtgtggtcttggccagcagcgccatccatctgctggatgagagagag
tcacccatcgctgcagctgtaggtattcagatgaagctagagttctttcagaggaagttc
tggaccgccagcagacagtgtgcggcgcttgatggaaagtgttcaatcagctgtgataac
gatgacatcagctgctacctcatagataataatggatttattattgtggccgaggatcag
tctttgactggtgtgttttttggagagcctgaaggagcggtgatgggcaaactggtgtca
atgggctcatttaagagggtgaatctgtatgactaccgggccatctgtagggtgtatgcg
cagaccagcgacacagcacacacacttctacacccctactttgctctgttcgcagctatc
cgatggctcctgacggagtttgtcatattcctggttgagtttaacctgtacagctggtgg
cactctgacctcaccattacagctcacagaggaggcagaactctgctggttccctgcgac
accgagtatccagccttcgtgtccgagcgcaccattaaagagactgtgggcaatattgac
tgtgaaagctgtgtgaaatcgtttgtgattcagcagattcccagcagtaatctcttcatg
gtggtcattgataacacatgtgactgcagcgacttcggacccgtgaccatggagcctgtc
gaaatcatgtataatgagtctctgaaatgtgagcggctgaagtttcagaaggacagaaga
cgtccagacacgtgccatccattccatcatgaggagaactcaatggagtgcggtggttca
gtcagtctgtctccatcctctccagctcttctagtgctaataatctccatcttcagcagg
tga

DBGET integrated database retrieval system