KEGG   Danio rerio (zebrafish): 100535241Help
Entry
100535241         CDS       T01004                                 

Definition
thrombospondin-2-like
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
dre  Danio rerio (zebrafish)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100535241
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100535241
  Cellular commiunity
   04510 Focal adhesion
    100535241
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100535241
  Exosomal proteins of colorectal cancer cells
   100535241
  Exosomal proteins of bladder cancer cells
   100535241
Heparan sulfate/heparin binding proteins [BR:dre00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100535241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 1175 aa AA seqDB search
MILRSNLCLWPLLLLCIRALPQDGLVEDESIFDLFKISGISRKTIGAKLFKGHDWDSPAY
RFIRFDHIPAVSTPALHQILKQVQNNEGFVFVATMRQDKGSRGTLLGVEGPGGLRQLEIV
SNGRANTLDLVYMVKGSQNVVSFEDVDLSDSQWKNISLYVHGENAHLYVGCSLIDSVILD
EPFYELLRPEGSQMFVAKGSIRENHFRGLLQNVQFLFDTPIENILRNKGCEIAKPEEVNV
VNESTESVSVGTSISTNFIGEKEKIASDVCERSCEELSNMVQELKGLRIIVGNLIDGLQK
VTEENTVMKEVLGNMKNIKDKRMCWQDGRLFEDKEDWVVDSCTKCTCQESKIVCHQITCP
PVACASPTFLDGECCPLCLPKDSEDGWSPWSEWTECTVTCGTGTQQRGRSCDATSNPCSG
PSIQTRRCSLGKCDSRVRQDGGWSLWSPWSSCSVTCGEGQITRIRHCNSPVPQLGGKDCE
GSGRETQKCEAKPCPIDGAWGPWSPWAVCSVTCGGGTRTRTRVCNSPRPQYGGKKCPGDS
VDTNACNKQDCPVDGCLSNPCFGGVECTSSPDGSWECGPCPLGFRGNGKVCEDVNECDMV
PDLCYKVGDSQRCVNTDPGFHCLPCPPRYKGNQPFGMGVEAAKLNKQVCEQENPCKEKTH
NCHRSAECIYLGHFSEPMFKCECKIGYAGDGLICGEDSDLDGWPNQNLVCGANQSYHCKK
DNCPKLPNSGQEDFDKDGQGDACDKDDDNDGIMDETDNCPLLYNPRQFDYDKDLVGDRCD
NCPYEHNPAQIDTDGNGEGDACAVDIDGDEVLNENDNCPYMYNTDQKDTDMDGVGDQCDN
CPLLHNPEQTDSDNDRVGDECDNNQDIDEDGHQNSLDNCPYIPNANQADHDKDGKGDACD
SDDDNDGVPDDKDNCRLVPNKDQRDSDGDGRGDACKDDFDNDSIPDFMDVCPENDAISNT
DFRKFQMVHLDPKGTAQIDPNWVVRHQGKELVQTANSDPGIAVGFDEFNAVDFSGTFYVN
TDRDDDYAGFVFGYQSSGRFYVVMWKQITQTYWEDNPSKAIGISGVSLKVVNSTTGTGEH
LRNALWHTGDTPGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGFIRVVVYEGKQIMADS
GPVYDQTFAGGRLGLFVFSQELVYFSDLKYECRDN
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
atgatactcaggagtaacctctgcttgtggcctttgctgttactatgtatcagagcacta
cctcaagatggccttgtggaagatgaatcaatcttcgatctcttcaaaatcagcggcatt
agcagaaaaacgattggagccaagctcttcaagggccacgactgggactcaccggcatat
cgtttcatccgctttgaccacatcccagctgtgagcaccccggcgctccatcagatcctt
aaacaggtccagaacaatgagggctttgtgtttgtggccaccatgagacaagacaagggc
tccaggggcaccttacttggagtggagggtcccggagggctccgtcagcttgagatagtg
tccaatggtcgcgccaacacactggatctggtctacatggtaaagggatcccagaacgtg
gtgtccttcgaggatgtggacctgtctgattcgcagtggaagaacatctcgctgtacgtt
catggggaaaacgctcacctgtatgtgggctgcagcctcatagacagcgtgatcctggat
gagcctttctatgagctcctgcgtccagagggcagccagatgtttgtggccaagggatct
atcagggaaaaccacttcaggggcttactgcaaaatgttcagttcctttttgacactcca
atagaaaacatcctgagaaacaaaggctgtgagattgccaaacctgaggaagttaacgtg
gttaatgagagtacagaatctgtgtctgtcggtacatctatatctaccaacttcattggg
gagaaggagaaaatagcatcagacgtgtgcgagcgctcttgtgaagagctcagtaacatg
gtccaggagctcaaaggtcttcgaatcatcgtgggcaatctcatcgatggcttgcagaaa
gtgactgaggagaacaccgtgatgaaggaggtgctgggaaacatgaagaacatcaaagac
aagcgcatgtgctggcaagacggccgtctctttgaggataaagaggactgggttgtggac
agctgcaccaagtgtacctgtcaggaatcaaagattgtgtgccatcaaatcacatgtcca
ccagtagcatgtgccagccccactttcctagatggcgagtgctgtccactgtgtctgcct
aaagacagcgaggacggctggtcaccttggtctgaatggacagagtgtacggtcacatgt
gggacgggcacgcaacaaagaggcaggtcatgtgatgccacaagtaacccctgcagtggc
ccatctatccaaacccgcagatgcagcttgggaaaatgcgacagtcgtgttcgtcaagat
ggtggttggagcttgtggtccccctggtcatcttgctctgtgacgtgtggagaaggacaa
atcacacgaattcgccactgcaactctcctgttcctcagctgggaggaaaggactgtgag
ggcagtgggagagagacgcaaaagtgtgaagctaaaccctgtccaattgatggagcctgg
ggcccctggtctccttgggcagtctgctctgtcacctgtggtggaggaacgaggacacga
acacgtgtgtgtaacagccctcgtccacagtatggaggaaagaaatgccctggagattcc
gtagacactaatgcctgtaataaacaggactgtcctgtggatggttgtctgtctaaccca
tgtttcgggggtgttgaatgcacaagctctcctgacggctcgtgggagtgtggtccgtgc
cctctcggcttccggggcaatggaaaagtgtgtgaggatgtcaatgagtgtgacatggtc
cccgatctgtgctataaagtgggtgattcccagcgttgtgtcaacacagacccaggattc
cactgcttgccttgtcctcctcgatacaaaggcaatcagccgtttggaatgggagtggag
gctgccaagctaaataaacaggtgtgtgagcaagaaaacccctgcaaggagaaaacccac
aactgccacaggtctgctgagtgcatttaccttggccacttcagcgaacccatgtttaag
tgtgagtgtaagatcggttatgctggggatggactcatctgtggcgaggactcagacctt
gatggctggcctaatcagaacctggtgtgtggagccaaccaatcctaccactgcaaaaag
gacaattgtcccaaacttccaaactcaggccaagaggattttgataaagacggtcaaggt
gacgcctgcgacaaagacgatgataatgatggaatcatggatgagactgacaactgtcct
ctactgtataatcccaggcaatttgactatgataaagatcttgtcggtgaccgctgtgat
aactgcccatacgagcacaatcctgctcagattgacacagacggtaatggcgaaggggac
gcctgtgctgttgacattgatggagatgaggttctgaatgagaatgataactgtccctac
atgtacaacactgaccagaaggacacggatatggatggagtgggtgaccagtgtgacaac
tgccctctgctgcacaaccctgagcagactgactcagataatgaccgagttggtgacgag
tgcgacaacaatcaagacattgatgaggacggccaccagaacagcctggataattgtcct
tacattcccaacgccaaccaggccgaccacgacaaagatgggaaaggagacgcttgcgat
tccgatgatgataatgacggagtcccagatgataaggacaactgcagactggtgcccaac
aaagaccaacgagactctgatggggatggaagaggcgacgcctgcaaagacgattttgac
aacgacagcattccagactttatggacgtgtgtcctgagaacgatgccatcagcaacaca
gacttccgcaagtttcagatggtgcatttggatcccaaaggaactgcgcaaattgatccc
aactgggtggtcagacatcaaggcaaagagctcgttcagaccgccaactcggaccctggc
attgcagtgggcttcgacgaattcaacgctgtggatttcagcggcactttttacgtcaac
acagatagagatgatgattatgctggctttgtgttcggctatcagtccagcgggcgcttt
tatgtggtaatgtggaagcagataacgcagacatactgggaggacaatccttcaaaagcc
atcggcatctctggggtttctctgaaagtggtcaactcgaccacaggcacaggagagcac
cttcgcaatgccctgtggcacactggggacacacctggacaggttcgcacactgtggcac
gaccctaagaacatcggctggaaggattacaccgcctacaggtggcacctcattcacaga
cccaagactggattcatcagagtggtggtttatgaggggaaacagatcatggcagactca
ggaccagtttatgatcaaacatttgcaggagggagattaggactcttcgtcttctctcag
gaactggtttatttctctgatctcaagtatgaatgtcgagataactga

DBGET integrated database retrieval system