KEGG   Danio rerio (zebrafish): 100535241Help
Entry
100535241         CDS       T01004                                 

Gene name
thbs2
Definition
thrombospondin 2
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
dre  Danio rerio (zebrafish)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100535241 (thbs2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100535241 (thbs2)
  Cellular commiunity
   04510 Focal adhesion
    100535241 (thbs2)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100535241 (thbs2)
  Exosomal proteins of colorectal cancer cells
   100535241 (thbs2)
  Exosomal proteins of bladder cancer cells
   100535241 (thbs2)
Heparan sulfate/heparin binding proteins [BR:dre00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100535241 (thbs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
13
AA seq 1175 aa AA seqDB search
MILRSNLCLWPLLLLCIRALPQDGLVEDESIFDLFKISGISRKTIGAKLFKGHDWDSPAY
RFIRFDHIPAVSTPALHQILKQVQNNEGFVFVATMRQDKGSRGTLLGVEGPGGLRQLEIV
SNGRANTLDLVYMVKGSQNVVSFEDVDLSDSQWKNISLYVHGENAHLYVGCSLIDSVILD
EPFYELLRPEGSQMFVAKGSIRENHFRGLLQNVQFLFDTPIENILRNKGCEIAKPEEVNV
VNESTESVSVGTSISTNFIGEKEKIASDVCERSCEELSNMVQELKGLRIIVGNLIDGLQK
VTEENTVMKEVLGNMKNIKDKRMCWQDGRLFEDKEDWVVDSCTKCTCQESKIVCHQITCP
PVACASPTFLDGECCPLCLPKDSEDGWSPWSEWTECTVTCGTGTQQRGRSCDATSNPCSG
PSIQTRRCSLGKCDSRVRQDGGWSLWSPWSSCSVTCGEGQITRIRHCNSPVPQLGGKDCE
GSGRETQKCEAKPCPIDGAWGPWSPWAVCSVTCGGGTRTRTRVCNSPRPQYGGKKCPGDS
VDTNACNKQDCPVDGCLSNPCFGGVECTSSPDGSWECGPCPLGFRGNGKVCEDVNECDMV
PDLCYKVGDSQRCVNTDPGFHCLPCPPRYKGNQPFGMGVEAAKLNKQVCEQENPCKEKTH
NCHRSAECIYLGHFSEPMFKCECKIGYAGDGLICGEDSDLDGWPNQNLVCGANQSYHCKK
DNCPKLPNSGQEDFDKDGQGDACDKDDDNDGIMDETDNCPLLYNPRQFDYDKDLVGDRCD
NCPYEHNPAQIDTDGNGEGDACAVDIDGDEVLNENDNCPYMYNTDQKDTDMDGVGDQCDN
CPLLHNPEQTDSDNDRVGDECDNNQDIDEDGHQNSLDNCPYIPNANQADHDKDGKGDACD
SDDDNDGVPDDKDNCRLVPNKDQRDSDGDGRGDACKDDFDNDSIPDFMDVCPENDAISNT
DFRKFQMVHLDPKGTAQIDPNWVVRHQGKELVQTANSDPGIAVGFDEFNAVDFSGTFYVN
TDRDDDYAGFVFGYQSSGRFYVVMWKQITQTYWEDNPSKAIGISGVSLKVVNSTTGTGEH
LRNALWHTGDTPGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGFIRVVVYEGKQIMADS
GPVYDQTFAGGRLGLFVFSQELVYFSDLKYECRDN
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
atgatactcaggagtaacctctgcttgtggcctttgctgttactatgtatcagagcacta
cctcaagatggccttgtggaagatgaatcaatcttcgatctcttcaaaatcagcggcatt
agcagaaaaacgattggagccaagctcttcaagggccacgactgggactcaccggcatat
cgtttcatccgctttgaccacatcccagctgtgagcaccccggcgctccatcagatcctt
aaacaggtccagaacaatgagggctttgtgtttgtggccaccatgagacaagacaagggc
tccaggggcaccttacttggagtggagggtcccggagggctccgtcagcttgagatagtg
tccaatggtcgcgccaacacactggatctggtctacatggtaaagggatcccagaacgtg
gtgtccttcgaggatgtggacctgtctgattcgcagtggaagaacatctcgctgtacgtt
catggggaaaacgctcacctgtatgtgggctgcagcctcatagacagcgtgatcctggat
gagcctttctatgagctcctgcgtccagagggcagccagatgtttgtggccaagggatct
atcagggaaaaccacttcaggggcttactgcaaaatgttcagttcctttttgacactcca
atagaaaacatcctgagaaacaaaggctgtgagattgccaaacctgaggaagttaacgtg
gttaatgagagtacagaatctgtgtctgtcggtacatctatatctaccaacttcattggg
gagaaggagaaaatagcatcagacgtgtgcgagcgctcttgtgaagagctcagtaacatg
gtccaggagctcaaaggtcttcgaatcatcgtgggcaatctcatcgatggcttgcagaaa
gtgactgaggagaacaccgtgatgaaggaggtgctgggaaacatgaagaacatcaaagac
aagcgcatgtgctggcaagacggccgtctctttgaggataaagaggactgggttgtggac
agctgcaccaagtgtacctgtcaggaatcaaagattgtgtgccatcaaatcacatgtcca
ccagtagcatgtgccagccccactttcctagatggcgagtgctgtccactgtgtctgcct
aaagacagcgaggacggctggtcaccttggtctgaatggacagagtgtacggtcacatgt
gggacgggcacgcaacaaagaggcaggtcatgtgatgccacaagtaacccctgcagtggc
ccatctatccaaacccgcagatgcagcttgggaaaatgcgacagtcgtgttcgtcaagat
ggtggttggagcttgtggtccccctggtcatcttgctctgtgacgtgtggagaaggacaa
atcacacgaattcgccactgcaactctcctgttcctcagctgggaggaaaggactgtgag
ggcagtgggagagagacgcaaaagtgtgaagctaaaccctgtccaattgatggagcctgg
ggcccctggtctccttgggcagtctgctctgtcacctgtggtggaggaacgaggacacga
acacgtgtgtgtaacagccctcgtccacagtatggaggaaagaaatgccctggagattcc
gtagacactaatgcctgtaataaacaggactgtcctgtggatggttgtctgtctaaccca
tgtttcgggggtgttgaatgcacaagctctcctgacggctcgtgggagtgtggtccgtgc
cctctcggcttccggggcaatggaaaagtgtgtgaggatgtcaatgagtgtgacatggtc
cccgatctgtgctataaagtgggtgattcccagcgttgtgtcaacacagacccaggattc
cactgcttgccttgtcctcctcgatacaaaggcaatcagccgtttggaatgggagtggag
gctgccaagctaaataaacaggtgtgtgagcaagaaaacccctgcaaggagaaaacccac
aactgccacaggtctgctgagtgcatttaccttggccacttcagcgaacccatgtttaag
tgtgagtgtaagatcggttatgctggggatggactcatctgtggcgaggactcagacctt
gatggctggcctaatcagaacctggtgtgtggagccaaccaatcctaccactgcaaaaag
gacaattgtcccaaacttccaaactcaggccaagaggattttgataaagacggtcaaggt
gacgcctgcgacaaagacgatgataatgatggaatcatggatgagactgacaactgtcct
ctactgtataatcccaggcaatttgactatgataaagatcttgtcggtgaccgctgtgat
aactgcccatacgagcacaatcctgctcagattgacacagacggtaatggcgaaggggac
gcctgtgctgttgacattgatggagatgaggttctgaatgagaatgataactgtccctac
atgtacaacactgaccagaaggacacggatatggatggagtgggtgaccagtgtgacaac
tgccctctgctgcacaaccctgagcagactgactcagataatgaccgagttggtgacgag
tgcgacaacaatcaagacattgatgaggacggccaccagaacagcctggataattgtcct
tacattcccaacgccaaccaggccgaccacgacaaagatgggaaaggagacgcttgcgat
tccgatgatgataatgacggagtcccagatgataaggacaactgcagactggtgcccaac
aaagaccaacgagactctgatggggatggaagaggcgacgcctgcaaagacgattttgac
aacgacagcattccagactttatggacgtgtgtcctgagaacgatgccatcagcaacaca
gacttccgcaagtttcagatggtgcatttggatcccaaaggaactgcgcaaattgatccc
aactgggtggtcagacatcaaggcaaagagctcgttcagaccgccaactcggaccctggc
attgcagtgggcttcgacgaattcaacgctgtggatttcagcggcactttttacgtcaac
acagatagagatgatgattatgctggctttgtgttcggctatcagtccagcgggcgcttt
tatgtggtaatgtggaagcagataacgcagacatactgggaggacaatccttcaaaagcc
atcggcatctctggggtttctctgaaagtggtcaactcgaccacaggcacaggagagcac
cttcgcaatgccctgtggcacactggggacacacctggacaggttcgcacactgtggcac
gaccctaagaacatcggctggaaggattacaccgcctacaggtggcacctcattcacaga
cccaagactggattcatcagagtggtggtttatgaggggaaacagatcatggcagactca
ggaccagtttatgatcaaacatttgcaggagggagattaggactcttcgtcttctctcag
gaactggtttatttctctgatctcaagtatgaatgtcgagataactga

DBGET integrated database retrieval system