KEGG   Danio rerio (zebrafish): 100537538Help
Entry
100537538         CDS       T01004                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4-like
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
GnRH signaling pathway
Melanogenesis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100537538
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100537538
   04020 Calcium signaling pathway
    100537538
   04070 Phosphatidylinositol signaling system
    100537538
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100537538
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    100537538
   04916 Melanogenesis
    100537538
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100537538
   04270 Vascular smooth muscle contraction
    100537538
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100537538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 1164 aa AA seqDB search
MDSAMDPLVFESNCFFKVDESGFFLTWKSEGKEGQVLEFSLINSIRDASALKDPKVLCAL
EASGKCESNLEDRIICICSGTDLVNLSFMYMVTQNPTTAKEWTDGLRSLIQNTRANNVCP
MTCLRKHWMRLSFLTNVNGQIPVRSITRTFASGKTEKGIFQALKDLGLPSGKNDEIQREI
FTFDKFYSLTQKICPRTDIEVLFKKFKGDKGDYLSVEQFVHFLNDNQRDPRLNEILFPFF
NSKCAFQIIQRYEPDEKLKRKGLLSCDGFCRFLMSDENAPVFLDRLEVYQEMDHPLSHYF
INSSHNTYLTGRQFGGKSSVEIYRQVLLTGCRCVELDCWDGKGEDQEPIITHGKAMCTDV
LFKDVIQGIKETAFLTSEYPVILSFENHCTKHQQYKLARYCEDIFGDLLLKQPLEDFPME
PGCPLPSPNDLKGKILIKNRRLKPEVEKKQLEDFRKHMEAGEPSVSTNLFEDENEDETNT
AELLNEAHPERIHGCLITEEENREEEVLLRHRKAEEENVADELAVIQSYTYVAATTNIHP
YLSNIINYAQAVKFTGFDEAEEKNIHHNMSSFNESVGLGYLRTNAIEFVNYNKRQMSRIY
PKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGSCGFLLKPDFMRRP
DRMFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMV
MNNGLNPVYNAEAFVFRKVILPDLAVLRVAVYDDNNKLIGQRILPLDGLQSGYRHISLRN
EYNKPLPLATVFCNIILKTYVPDGFGAIVDALSDPKKFLSICEKRTDQMRAMGIEASDIA
DVPSDVWKGNKKRKTNQAGMMMKPQKDSDRPRENMPISSKEDSSVLTPQLTIDDLKQTKT
FLKLIKKQQKEVNALKKKHAKAHAALRSSHSAQLDRTVAQHEKEKHTLEKQLHKNTSRKV
SESSSLEMSRDIEQQMKTAVMNHKSKVKDMASAQASECSEMLRWHSAEEQTVVEQHLLQQ
CEQLHKLLMLEQEQQTHQLTLLHERQSKEMRTNQAKTSMESSKAISQDKSIKNKAERERR
VRELNSTNTRKFLTERKRLAMKQTKECEQLQAAQREQLERLEKHNEELSNSCYAKSQCQG
QNEAVCGDMREDEPLTGQTHMSLQ
NT seq 3495 nt NT seq  +upstreamnt  +downstreamnt
atggattcagcaatggatcctttggtctttgaatcgaactgtttcttcaaagtagacgag
tctggattcttcctgacatggaaaagcgaaggaaaggagggtcaagttttggagttttcg
ctgatcaacagtatacgtgatgccagtgctctaaaggacccaaaggttctctgtgcactg
gaggcttcaggaaagtgtgaaagtaacctggaggacagaatcatctgcatatgcagcggc
acagatctggtcaacctgagcttcatgtacatggtcacacaaaaccccacaactgctaag
gagtggacagacggcttgcgctcattgattcagaacacaagagcgaataacgtgtgtccg
atgacctgcctgagaaaacattggatgcggttgtcatttttaaccaacgtgaatggacaa
atacccgtcagaagcatcacaagaaccttcgcctctggcaaaacagagaagggaattttc
caggcgctgaaggatctcggtttacccagtggaaagaatgatgaaatccagcgcgagatc
ttcacttttgacaagttctacagccttacgcagaaaatctgtcccagaactgacattgaa
gtacttttcaagaaatttaagggagacaaaggtgattatttgagtgttgagcagttcgtc
cactttttgaatgataatcagagagatccacgtctgaatgaaatactgtttccgttcttc
aactctaaatgtgctttccaaatcatacagagatatgagcctgatgagaaactgaagagg
aaaggtctgctgtcgtgtgatggtttctgtcggtttctgatgtcggatgaaaacgctcct
gtgtttctggatcggttggaggtttaccaggagatggatcatccgctatctcattacttc
atcaactcctctcacaacacttacctgaccggcagacagtttggagggaaatcctcagtg
gagatttacagacaggtgctgctgaccggctgcaggtgtgttgagttggactgctgggat
ggaaaaggtgaagatcaggagcccataatcacccacggcaaggccatgtgtacagacgtc
ctattcaaggatgtgattcagggaattaaagaaaccgccttcctgacatcagagtatcct
gtgatcctgtcctttgaaaaccactgcacgaaacatcagcagtataaactggctcgttac
tgcgaagacatttttggagatttgcttttgaaacagccgttagaggatttcccgatggag
cctggatgtccactgccgtctccaaatgacctcaaaggaaaaatcctcatcaagaacaga
agactaaaacctgaagttgaaaaaaaacagctggaggacttcaggaaacacatggaggcc
ggagagccgagcgtctccacaaacctgtttgaagatgagaacgaggatgagacaaacacc
gctgagctgttgaatgaagctcatcccgagcggattcacggatgtttgatcactgaggag
gagaatcgagaggaagaggtgctgctaagacacagaaaggctgaggaggagaatgtggca
gatgaactggctgtgattcagtcgtacacatatgtcgcggccaccaccaacatccacccg
tatctgtccaacatcatcaactacgcccaggctgtaaagtttaccggctttgatgaggct
gaggaaaaaaatatccaccacaacatgtcttccttcaatgagtctgtcggtttgggatat
ttgaggacaaacgccatcgagtttgtgaactacaacaaacgccagatgagccgcatctac
cccaaaggaggacgagtggactccagtaattacatgccacagatcttctggaatgccggc
tgccagatggtttccctgaacttccagaccccagatctggcaatgcagctcaaccagggg
aagtttgaatataatggctcttgtgggttcctcctgaagccggattttatgcggagaccc
gatcgtatgtttgacccattctctgagacgcctgtggatggagtgatcgcagcaacatgc
agcgtgcaggtgatctcagggcagttcctgtcagataagaagatcggcacatatgtagaa
gtggacatgtatggactcccgaccgacaccattcgcaaagagtttcgcactcggatggtg
atgaacaacggcctgaacccggtctacaacgcagaagcctttgtcttcaggaaggtgatt
ctgccagacctcgcagtgctccgtgtggctgtatatgatgataacaataagctgattggc
cagcggattctccctctggacggactgcagtctggttacaggcacatctccctacgaaac
gagtacaacaaacctctgcctctggccaccgtcttctgcaatatcatcctcaaaacatac
gtgcccgatggattcggagctattgtggatgctttgtctgatcccaagaagtttttatcc
atctgtgagaaaagaacggaccaaatgagagccatgggcattgaggcgtcagatattgct
gatgtgccgagtgacgtctggaaggggaataagaaaagaaaaacaaatcaggccgggatg
atgatgaaaccacagaaagactcagacagacccagagaaaatatgcccatctcctccaaa
gaggattcatcggttctaactccacagctgaccatcgatgacctcaagcaaacaaagact
tttctgaaactcatcaagaagcagcagaaagaagtgaacgctttgaagaaaaagcacgca
aaggcacacgctgcactgcggagctcccacagcgctcaactggacaggactgtagctcaa
catgagaaagagaaacacacgctggagaagcagctccacaaaaacaccagcaggaaagtg
agtgaaagctccagccttgaaatgagcagagacattgaacagcaaatgaagacagcggtg
atgaatcacaagtcaaaggtgaaggacatggcatccgctcaggcctcggagtgttcagag
atgttgcgctggcactcagctgaagaacagacagtggtggagcagcatctcctccagcag
tgtgagcagctccacaaactgctgatgctggagcaggagcagcaaacacaccagctcaca
ctcctgcacgaacgtcagagtaaagagatgcggaccaaccaagccaagacctcaatggag
agcagcaaggccatcagtcaagacaaaagcataaagaacaaggctgagcgagagcggaga
gttcgagagctcaacagcacgaacacaagaaagtttcttacagaaagaaaaaggctcgcc
atgaaacagaccaaggagtgcgagcaactccaggcggctcagcgggaacaactggagagg
ctggagaaacacaatgaggagctgtcgaactcgtgctatgcaaaatcacaatgccaaggc
cagaatgaagcagtgtgtggagacatgagagaggacgaaccgctgaccggtcaaacacac
atgtcactgcagtga

DBGET integrated database retrieval system