KEGG   Danio rerio (zebrafish): 114401Help
Entry
114401            CDS       T01004                                 

Gene name
bcl2l1, bcl2l, blp1, cb1021, zfBLP1
Definition
bcl2-like 1
Orthology
K04570  
BCL2-like 1 (apoptosis regulator Bcl-X)
Organism
dre  Danio rerio (zebrafish)
Pathway
Apoptosis
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    114401 (bcl2l1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    114401 (bcl2l1)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     114401 (bcl2l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
23
AA seq 238 aa AA seqDB search
MSYYNRELVVFFIKYKLSQRNYPCNHIGLTEDTNRTDGAEENGEGAAGATTLVNGTMNRT
NASSTGTPPQSPASSPQRQTNGSGGLDAVKEALRDSANEFELRYSRAFNDLSSQLHITPA
TAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIAEWMTVYLDNH
IQPWIQSQGGWERFAEIFGKDAAAESRKSQESFKKWLFAGMTLLTGVVVGGLIAQKRL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtcttactataaccgagaactggtggtattttttatcaaatataaactctcgcagagg
aactacccctgcaaccacattggacttacagaagacacaaatcggactgatggggctgaa
gagaatggcgagggggcagcaggagcgacaactcttgttaatggcaccatgaatagaacg
aacgctagttccactgggaccccaccacaatcccctgcttcatccccccagcgtcaaaca
aatgggtctgggggtctagacgcagtgaaggaggcgcttcgtgattctgccaacgagttt
gagctgcgctattccagagcattcaacgatctttcctcacagctccacatcacacccgcc
acagcgtaccagagcttcgagagcgtgatggatgaggtgtttcgcgacggcgtcaactgg
ggccgaatcgtggggttgttcgcattcggaggggctctgtgcgtcgagtgtgtggagaag
gagatgagtccgcttgtgggacgcatcgcagaatggatgaccgtctacctagacaaccat
attcaaccctggatccaaagccaaggaggatgggaacgctttgcagagatctttggaaaa
gatgcagcggcggaaagcaggaaatcgcaagaaagcttcaagaaatggttgtttgcagga
atgaccttgctcacgggtgtcgtcgttgggggactcattgcacagaaacgcctgtga

DBGET integrated database retrieval system