KEGG   Danio rerio (zebrafish): 114549Help
Entry
114549            CDS       T01004                                 

Gene name
ache, zgc:92550
Definition
acetylcholinesterase (EC:3.1.1.7)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    114549 (ache)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     114549 (ache)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
7
AA seq 634 aa AA seqDB search
MKTSDILLLPTVLLTFLFHNCFAQAEPDLVVATRLGRVQGTRLPVPDRSHVIAFLGIPYA
EPPIGKRRFKRAEPKKPWNNVFEAKEFSNACYQFVDTSYPGFPGIEMWNPNRVMSEDCLY
LNVWVPPTPRPQNLTVMVWIYGGGFYSGSSSLDVYDGRYLAYTEKVVVVSMNYRVGAFGF
LALNGSSDAPGNVGLYDQRLALQWVQENIHFFGGNPKQVTIFGESAGAASVGMHVLSPDS
RPLFTRAILQSGVPNTPWATVTFDEARRRTTKLGKLVGCTWGNDTELIDCLRNKHPQELI
DQEWQVLPWSSLFRFSFVPVVDGVFFPDTPDAMISSGNFKYTQILLGVNQDEGSYFLLYG
APGFSKDNESLISREDFLESVKMGVPHANDIGLEAVILQYTDWMDENNGQKNRDAMDDIV
GDQNVICPLQHFAKSYAQYAALHAQSSAAAPGTLGWGNSGPTGYNSGNSHGAVYLYLFDH
RASNLAWPEWMGVIHGYEIEFVFGLPLEKRLNYTAEEEKLSRRIMRYWANFARTGNPNVN
TDGTMDSRRRWPQFSANEQKHVGLNTEPMKVHKGLRTQFCALWNRFLPRLLNITDNIDDV
ERQWKVEFHRWSSYMMHWKSQFDHYSKQERCTDL
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgaagacctcagatattttgctcttgcccactgtgctactcacgttcctcttccataac
tgtttcgcacaggctgaacctgacctcgtagtagcaacaagattgggcagagtgcagggt
acaagattgcctgttccagaccggagtcatgtgattgctttcttaggcatcccatatgct
gaaccacccattgggaagaggcgtttcaagagagctgagcccaaaaagccctggaataat
gtctttgaggctaaagagttctcaaatgcctgctatcagtttgtggatacctcttacccg
ggctttccaggtattgaaatgtggaaccccaacagagtgatgagtgaagactgtctttat
ctgaacgtgtgggtacctcctacgcccagaccacagaacctcacagttatggtctggata
tatggtggtggcttctatagtggctcttcctctcttgatgtctatgatggtcgttacctg
gcttacactgaaaaggtagtggttgtgtctatgaactatcgtgttggagcttttggattc
cttgcccttaatggctcatcagacgcacctggaaatgtgggtctctatgaccagagattg
gccctccagtgggtacaagaaaacatccacttctttggcggtaacccaaaacaggtcacc
atttttggagaaagtgctggggcagcatcagttggcatgcatgttctgtcaccagacagc
cgccccctcttcacacgtgccatattgcagagtggtgttccaaatacaccctgggccact
gttacctttgatgaggcccgtcggagaaccaccaagttgggcaaactggttggttgcacc
tggggcaatgatactgaactgattgattgtctgaggaataaacatccacaggaactaatt
gatcaggagtggcaagttcttccctggagcagccttttccgcttttcctttgtgcctgtc
gtcgatggggttttctttcccgacaccccagatgcaatgattagctctgggaacttcaaa
tacactcagatcctgttgggcgtaaatcaggatgagggatcttacttcttgctttatggg
gcaccaggtttcagtaaagacaatgagagtttgatatctcgggaagacttcctggaaagt
gtgaagatgggtgttccacatgccaatgacattggcttggaagcagttatccttcaatac
actgattggatggatgagaacaacggccaaaagaatagagatgccatggacgatattgta
ggagatcaaaatgtcatctgtcctctacagcattttgcaaagtcatacgcacaatacgct
gccctccatgcccagtcatcagcggcagctccaggaacactaggctggggaaactcagga
ccaacaggctacaacagtggcaactcgcatggtgctgtgtacctttatctgtttgaccat
cgagcctcaaacctggcctggcctgagtggatgggcgtcatccacggctatgagattgag
tttgtatttggcctgccattagagaagcgactcaattacacagcagaggaggagaaactc
agtcgacgaataatgagatactgggctaatttcgcccgcactggtaatcccaatgttaat
actgatggcaccatggacagtcggagacgatggccccaattttcagctaatgagcaaaag
catgtgggcttgaacacagagccaatgaaggtgcacaagggtctaagaacacagttctgt
gctctgtggaaccgcttcctgcctcgtctgcttaacatcacagataacattgatgatgtt
gagcgacagtggaaagtggagtttcatcgctggagctcttacatgatgcactggaagagc
cagttcgaccattacagcaagcaggagcgctgcacagatctctag

DBGET integrated database retrieval system