KEGG   Danio rerio (zebrafish): 140634Help
Entry
140634            CDS       T01004                                 

Gene name
cyp1a, cyp1a1, wu:fb63b04, zfCYP1A, zgc:109747
Definition
cytochrome P450, family 1, subfamily A
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:dre00140]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:dre00380]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:dre00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:dre00980]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
18; 21
AA seq 519 aa AA seqDB search
MALTILPILGPISVSESLVAIITICLVYLLMRLNRTKIPDGLQKLPGPKPLPIIGNVLEI
GNNPHLSLTAMSKCYGPVFQIQIGMRPVVVLSGNDVIRQALLKQGEEFSGRPELYSTKFI
SDGKSLAFSTDQVGVWRARRKLALNALRTFSTVQGKSPKYSCALEEHISNEGLYLVQRLH
SVMKADGSFDPFRHIVVSVANVICGICFGRRHSHDDDELVRLVNMSDEFGKIVGSGNPAD
FIPFLRILPSTTMKKFLDINERFSKFMKRLVMEHYDTFDKDNIRDITDSLINHCEDRKLD
ENSNLQVSDEKIVGIVNDLFGAGFDTISTALSWAVVYLVHYPEVQERLQRELDEKIGKDR
TPLLSDRANLPLLESFILEIFRHSSFLPFTIPHCTSKDTSLNGYFIPKDTCVFVNQWQVN
HDPELWKDPSSFIPDRFLTADGTELNKLEGEKVLVFGLGKRRCIGESIGRAEVFLFLAIL
LQRLKFTGMPGEMLDMTPEYGLTMKHKRCLLRVTPQPGF
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggctctgactattcttccaatattgggtccgatttctgtgtctgagagtctcgtggcc
attataacaatatgtttggtgtatctgctcatgcgcctaaaccgcacgaaaatcccagac
gggctacagaagcttcccggcccgaagcctctgccgattatcggaaatgtcctggaaatc
ggaaacaacccacatttgagtctgacggccatgagtaagtgctatggcccggtttttcag
atccagatcggcatgcgtcctgttgtcgtactcagtgggaatgatgtgatccgacaggcg
ctcctaaaacagggcgaagagttttccggacgtccagaattgtacagcaccaagttcatc
agtgatggaaagagtctggcgttcagtacggatcaagtcggagtctggagagcacgccga
aagctggcgctcaatgccctgcgaacattttcaacggtgcagggaaagagtcccaaatat
tcctgcgccctagaggagcacatcagtaatgagggtttatatttggtccagaggctgcac
tctgttatgaaagccgatggaagctttgatccattcagacatatcgtagtatccgtggct
aacgtaatctgcgggatctgtttcggacgccggcatagtcatgatgatgatgaactggtg
cgactggttaatatgagcgatgagttcgggaagatcgtgggcagcggaaaccctgccgat
ttcatccctttcctgcgcattctgccgagcacgacgatgaagaagttcctggatatcaac
gaacgcttcagtaaattcatgaagaggctggtgatggagcattacgatacgttcgataag
gacaacatcagagacatcaccgactctcttatcaaccactgcgaagaccgaaaactggac
gaaaactccaacctgcaagtgtccgatgagaagatcgtaggaatcgtcaatgacctattc
ggagccggtttcgacactatcagtacggctctgtcctgggcggttgtctatctagtgcac
tacccagaggtccaggagcgactgcaaagagaattggatgaaaagatcgggaaggatcgc
acaccactgttatctgacagggcgaacctgccgcttctggagtccttcattctggagatc
ttccgtcattcatccttccttcccttcaccattcctcactgcacatccaaagacacgtca
ctcaatggctattttattcccaaagacacctgcgtgtttgtaaaccagtggcaagtcaac
catgacccagaactgtggaaggatccctcgtcttttattcccgaccggttcctcactgcg
gacggtactgaactgaataagttggaaggcgagaaggtgttggttttcggtttgggaaag
cgccgctgcattggagagtccatcggacgcgctgaagtcttcctgttcctggccatcctg
ctgcaaaggttaaagttcaccgggatgccaggagaaatgctggatatgaccccagagtac
gggttgaccatgaaacacaagcggtgtcttcttcgggtcacaccacagcctgggttctag

DBGET integrated database retrieval system