KEGG   Danio rerio (zebrafish): 140634Help
Entry
140634            CDS       T01004                                 

Gene name
cyp1a, cyp1a1, wu:fb63b04, zfCYP1A, zgc:109747
Definition
cytochrome P450, family 1, subfamily A (EC:1.14.14.1)
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    140634 (cyp1a)
  Amino acid metabolism
   00380 Tryptophan metabolism
    140634 (cyp1a)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    140634 (cyp1a)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    140634 (cyp1a)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     140634 (cyp1a)
Cytochrome P450 [BR:dre00199]
 Cytochrome P450, animal type
  CYP1 family
   140634 (cyp1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
18; 21
AA seq 519 aa AA seqDB search
MALTILPILGPISVSESLVAIITICLVYLLMRLNRTKIPDGLQKLPGPKPLPIIGNVLEI
GNNPHLSLTAMSKCYGPVFQIQIGMRPVVVLSGNDVIRQALLKQGEEFSGRPELYSTKFI
SDGKSLAFSTDQVGVWRARRKLALNALRTFSTVQGKSPKYSCALEEHISNEGLYLVQRLH
SVMKADGSFDPFRHIVVSVANVICGICFGRRHSHDDDELVRLVNMSDEFGKIVGSGNPAD
FIPFLRILPSTTMKKFLDINERFSKFMKRLVMEHYDTFDKDNIRDITDSLINHCEDRKLD
ENSNLQVSDEKIVGIVNDLFGAGFDTISTALSWAVVYLVHYPEVQERLQRELDEKIGKDR
TPLLSDRANLPLLESFILEIFRHSSFLPFTIPHCTSKDTSLNGYFIPKDTCVFVNQWQVN
HDPELWKDPSSFIPDRFLTADGTELNKLEGEKVLVFGLGKRRCIGESIGRAEVFLFLAIL
LQRLKFTGMPGEMLDMTPEYGLTMKHKRCLLRVTPQPGF
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggctctgactattcttccaatattgggtccgatttctgtgtctgagagtctcgtggcc
attataacaatatgtttggtgtatctgctcatgcgcctaaaccgcacgaaaatcccagac
gggctacagaagcttcccggcccgaagcctctgccgattatcggaaatgtcctggaaatc
ggaaacaacccacatttgagtctgacggccatgagtaagtgctatggcccggtttttcag
atccagatcggcatgcgtcctgttgtcgtactcagtgggaatgatgtgatccgacaggcg
ctcctaaaacagggcgaagagttttccggacgtccagaattgtacagcaccaagttcatc
agtgatggaaagagtctggcgttcagtacggatcaagtcggagtctggagagcacgccga
aagctggcgctcaatgccctgcgaacattttcaacggtgcagggaaagagtcccaaatat
tcctgcgccctagaggagcacatcagtaatgagggtttatatttggtccagaggctgcac
tctgttatgaaagccgatggaagctttgatccattcagacatatcgtagtatccgtggct
aacgtaatctgcgggatctgtttcggacgccggcatagtcatgatgatgatgaactggtg
cgactggttaatatgagcgatgagttcgggaagatcgtgggcagcggaaaccctgccgat
ttcatccctttcctgcgcattctgccgagcacgacgatgaagaagttcctggatatcaac
gaacgcttcagtaaattcatgaagaggctggtgatggagcattacgatacgttcgataag
gacaacatcagagacatcaccgactctcttatcaaccactgcgaagaccgaaaactggac
gaaaactccaacctgcaagtgtccgatgagaagatcgtaggaatcgtcaatgacctattc
ggagccggtttcgacactatcagtacggctctgtcctgggcggttgtctatctagtgcac
tacccagaggtccaggagcgactgcaaagagaattggatgaaaagatcgggaaggatcgc
acaccactgttatctgacagggcgaacctgccgcttctggagtccttcattctggagatc
ttccgtcattcatccttccttcccttcaccattcctcactgcacatccaaagacacgtca
ctcaatggctattttattcccaaagacacctgcgtgtttgtaaaccagtggcaagtcaac
catgacccagaactgtggaaggatccctcgtcttttattcccgaccggttcctcactgcg
gacggtactgaactgaataagttggaaggcgagaaggtgttggttttcggtttgggaaag
cgccgctgcattggagagtccatcggacgcgctgaagtcttcctgttcctggccatcctg
ctgcaaaggttaaagttcaccgggatgccaggagaaatgctggatatgaccccagagtac
gggttgaccatgaaacacaagcggtgtcttcttcgggtcacaccacagcctgggttctag

DBGET integrated database retrieval system